DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr3

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:375 Identity:122/375 - (32%)
Similarity:179/375 - (47%) Gaps:74/375 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ATFTSTTATES-SPLIGKVISNSRAP----QIAH----EMLVEYFMALLVI-----MGLTAPVDK 59
            :||.|::.::| ||......::|.:.    .:||    |.....|.:|..:     ..|.|..|.
  Fly   150 STFLSSSQSQSPSPPAASASASSPSSFSSFAVAHGPQTEATNHTFKSLAFLDASFGSDLFAQTDA 214

  Fly    60 QSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALG-TTARLHCRVRHLGDRAVS 123
            :..||.      ||.||..:  .|...:: |:||....|.:....| |.|.:.|||..|.|::||
  Fly   215 KRERSG------AADEESQD--ADTSQSL-PIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVS 270

  Fly   124 WIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKL 188
            |||:|||||||:|..|||:|:||......:|.||.|.:.:...:|:|:|||||:||||:|:|::|
  Fly   271 WIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQL 335

  Fly   189 VVV----TSKAQILANRELFIQSGSDINLTCIAPQAP----GPYTHMLWHKDTELVS-------- 237
            .::    .:||.|....:|..::||.|.|.|:..|..    ||   :.|::...:::        
  Fly   336 NIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQQPSVKDIGP---IYWYRGEHMITPFDADDGQ 397

  Fly   238 ----------------DSARGGIRVESEQQMK---------------TSNLVISRVQHTDSGNYT 271
                            |::...|..|.:.||:               .|.|.||..|.||:||||
  Fly   398 PEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYT 462

  Fly   272 CSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLL 321
            |....::|.||.||:|..|..||||........|.||.|||..:||..||
  Fly   463 CQPTTASSASVLVHVINDENPAAMQKSGACPCALGPLQLLLHLLLLPELL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 46/96 (48%)
IG_like 98..179 CDD:214653 39/81 (48%)
IG_like 206..278 CDD:214653 26/114 (23%)
Ig 211..278 CDD:143165 24/109 (22%)
dpr3NP_001014459.2 Ig 243..330 CDD:299845 43/86 (50%)
IG_like 243..329 CDD:214653 42/85 (49%)
Ig 350..464 CDD:299845 26/116 (22%)
IG_like <441..477 CDD:214653 16/35 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444738
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.