DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr3

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:375 Identity:122/375 - (32%)
Similarity:179/375 - (47%) Gaps:74/375 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ATFTSTTATES-SPLIGKVISNSRAP----QIAH----EMLVEYFMALLVI-----MGLTAPVDK 59
            :||.|::.::| ||......::|.:.    .:||    |.....|.:|..:     ..|.|..|.
  Fly   150 STFLSSSQSQSPSPPAASASASSPSSFSSFAVAHGPQTEATNHTFKSLAFLDASFGSDLFAQTDA 214

  Fly    60 QSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALG-TTARLHCRVRHLGDRAVS 123
            :..||.      ||.||..:  .|...:: |:||....|.:....| |.|.:.|||..|.|::||
  Fly   215 KRERSG------AADEESQD--ADTSQSL-PIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVS 270

  Fly   124 WIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKL 188
            |||:|||||||:|..|||:|:||......:|.||.|.:.:...:|:|:|||||:||||:|:|::|
  Fly   271 WIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQL 335

  Fly   189 VVV----TSKAQILANRELFIQSGSDINLTCIAPQAP----GPYTHMLWHKDTELVS-------- 237
            .::    .:||.|....:|..::||.|.|.|:..|..    ||   :.|::...:::        
  Fly   336 NIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQQPSVKDIGP---IYWYRGEHMITPFDADDGQ 397

  Fly   238 ----------------DSARGGIRVESEQQMK---------------TSNLVISRVQHTDSGNYT 271
                            |::...|..|.:.||:               .|.|.||..|.||:||||
  Fly   398 PEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYT 462

  Fly   272 CSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLL 321
            |....::|.||.||:|..|..||||........|.||.|||..:||..||
  Fly   463 CQPTTASSASVLVHVINDENPAAMQKSGACPCALGPLQLLLHLLLLPELL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 4/17 (24%)
IG_like 98..179 CDD:214653 39/81 (48%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 3/7 (43%)
CDR1 114..120 CDD:409355 2/5 (40%)
FR2 121..132 CDD:409355 8/10 (80%)
Ig strand C 121..127 CDD:409355 4/5 (80%)
Ig strand C' 130..133 CDD:409355 2/2 (100%)
CDR2 133..146 CDD:409355 7/12 (58%)
Ig strand D 146..151 CDD:409355 1/4 (25%)
FR3 147..176 CDD:409355 9/28 (32%)
Ig strand E 155..162 CDD:409355 3/6 (50%)
Ig strand F 170..177 CDD:409355 5/6 (83%)
IG_like 206..278 CDD:214653 26/114 (23%)
Ig strand B 211..215 CDD:409353 2/3 (67%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 2/3 (67%)
Ig strand F 269..274 CDD:409353 4/4 (100%)
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 42/85 (49%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 269..272 CDD:409353 2/2 (100%)
Ig strand E 304..308 CDD:409353 2/3 (67%)
Ig strand F 318..323 CDD:409353 3/4 (75%)
IG_like <441..477 CDD:214653 16/35 (46%)

Return to query results.
Submit another query.