DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr4

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:247 Identity:134/247 - (54%)
Similarity:172/247 - (69%) Gaps:3/247 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IPDNY---DAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTN 142
            :|.:|   ....|.|||::.|||.|.:|..|.||||||:||||||||||:|||||||:||:||||
  Fly    33 VPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTN 97

  Fly   143 DQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQS 207
            ||||.:.|.:.||||.|:|.|.|.||:|.||||||||||||..::|.||.|:|:||.|.||||:|
  Fly    98 DQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELFIKS 162

  Fly   208 GSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTC 272
            ||||||||:|.|:|.|.:.:.|:|...:::.|.||||.|.:|:..:||.|:|::....|||||||
  Fly   163 GSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTC 227

  Fly   273 SADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLLGPT 324
            |..:|:|.||.||:|..|..|||||...|...|.||....:..:|...:..|
  Fly   228 SPSSSDSASVVVHVINGEHPAAMQHGNSSATCLRPLSSTSVPFVLATWMSMT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 64/95 (67%)
IG_like 98..179 CDD:214653 57/80 (71%)
IG_like 206..278 CDD:214653 34/71 (48%)
Ig 211..278 CDD:143165 30/66 (45%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 64/92 (70%)
IG_like 53..145 CDD:214653 64/91 (70%)
ig 153..227 CDD:278476 37/73 (51%)
IG_like 161..>227 CDD:214653 31/65 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444798
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104900at50557
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.