DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Sdk1

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_808547.3 Gene:Sdk1 / 330222 MGIID:2444413 Length:2193 Species:Mus musculus


Alignment Length:330 Identity:81/330 - (24%)
Similarity:127/330 - (38%) Gaps:68/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TATESSPLIGKVISNSRAPQIAHEM---LVEYFMALLVIMGLTAP-----------VDKQSRRSS 65
            ||...|.::|:|......|..|..:   .::::...:.:..|..|           :.|.|...|
Mouse   371 TAEPESRILGEVEETMDIPCRAMGVPLPTLQWYKDAVPLSKLQNPRYKVLPSGGLHIQKLSPEDS 435

  Fly    66 QYFGHLAAAE----------ELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDR 120
            ..|...|:.|          :::|:.|.....  ||....||       |.||.|.|.|......
Mouse   436 GIFQCFASNEGGEVQTHTYLDVTNIAPAFTQR--PVDTTVTD-------GMTAVLRCEVSGAPKP 491

  Fly   121 AVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYEC-QVSTEPKISL 184
            |::|  :|..|||..|.:..   .||:.     .:...|:|..|..:|||.|.| ..:||..::.
Mouse   492 AITW--KRGNHILASGSVRI---PRFML-----LESGGLRIAPVFIQDAGNYTCYAANTEASVNA 546

  Fly   185 AYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESE 249
            :..|.|....:.:....:..:..|:...|.|.|...|......:|.||..:::.|:...|.||  
Mouse   547 SAMLTVWNRTSIVHPPEDRVVIKGTTATLCCGATHDPRTSLRYVWKKDNVVITASSSSRIVVE-- 609

  Fly   250 QQMKTSNLVISRVQHTDSGNYTC---SADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLL 311
               |..:||||:....|.|:|||   |...|:|.:..:.:|:                ||..|..
Mouse   610 ---KDGSLVISQTWSGDIGDYTCEIISEGGSDSRTARLEVIE----------------LPHPPQN 655

  Fly   312 LLAVL 316
            |||.|
Mouse   656 LLASL 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 28/96 (29%)
IG_like 98..179 CDD:214653 23/81 (28%)
IG_like 206..278 CDD:214653 23/74 (31%)
Ig 211..278 CDD:143165 22/69 (32%)
Sdk1NP_808547.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Ig_2 94..169 CDD:290606
IG_like 100..169 CDD:214653
IG_like 183..263 CDD:214653
Ig 197..247 CDD:299845
IG_like 281..357 CDD:214653
IGc2 294..347 CDD:197706
I-set 368..457 CDD:254352 15/85 (18%)
Ig 388..454 CDD:143165 10/65 (15%)
I-set 462..552 CDD:254352 31/108 (29%)
Ig 476..552 CDD:299845 26/85 (31%)
I-set 557..646 CDD:254352 25/93 (27%)
Ig 562..646 CDD:299845 25/88 (28%)
FN3 650..741 CDD:238020 6/11 (55%)
fn3 753..839 CDD:278470
FN3 854..949 CDD:238020
FN3 954..1036 CDD:238020
FN3 1052..1148 CDD:238020
FN3 1158..1253 CDD:238020
FN3 1261..1349 CDD:238020
FN3 1360..1453 CDD:238020
FN3 1459..1554 CDD:238020
FN3 1562..1676 CDD:238020
FN3 1686..1779 CDD:238020
FN3 1784..1865 CDD:238020
FN3 1885..1978 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2057..2080
PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 2187..2193
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.