DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr18

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:296 Identity:75/296 - (25%)
Similarity:124/296 - (41%) Gaps:72/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DPVFDNTTDREVIAA--LGTTARLHCRVRHLGDRAVSWIRQ--RDLHILTIGIMTYTNDQRFLAR 149
            :|:...|:...:::|  |.|.|.|:|||..|.|:.|.|:|:  ..:.:||:|.:||:.|.|...:
  Fly   221 EPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVK 285

  Fly   150 HIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRE-----LFIQSGS 209
             ....:.|.|.|...|..|||||.|||||.|.......|.|:....:|:...|     .:.:|||
  Fly   286 -FQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGS 349

  Fly   210 DINLTCIAPQAPGPYTHMLWHKDTELV---SDSARGGIRVESEQQMKTSNLV--ISRVQH----- 264
            .::|.|       ..:...:.|:.:.:   :|||...::....:.....||:  :::.||     
  Fly   350 TVDLQC-------QISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQ 407

  Fly   265 ---------------------------------------------TDSGNYTCSADNSNSDSVFV 284
                                                         :|||||:||.....:..|.|
  Fly   408 DLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQV 472

  Fly   285 HIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVL 320
            .::..|..||:||.:|||..:..|.:|...::|:.|
  Fly   473 QVLTGELPAAVQHNIGSRTEIYSLAMLGHLLVLIFL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 37/99 (37%)
IG_like 98..179 CDD:214653 33/84 (39%)
IG_like 206..278 CDD:214653 20/126 (16%)
Ig 211..278 CDD:143165 17/121 (14%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 33/83 (40%)
Ig <258..326 CDD:299845 25/68 (37%)
IGc2 <417..461 CDD:197706 5/43 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.