DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr18

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:296 Identity:75/296 - (25%)
Similarity:124/296 - (41%) Gaps:72/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DPVFDNTTDREVIAA--LGTTARLHCRVRHLGDRAVSWIRQ--RDLHILTIGIMTYTNDQRFLAR 149
            :|:...|:...:::|  |.|.|.|:|||..|.|:.|.|:|:  ..:.:||:|.:||:.|.|...:
  Fly   221 EPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVK 285

  Fly   150 HIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRE-----LFIQSGS 209
             ....:.|.|.|...|..|||||.|||||.|.......|.|:....:|:...|     .:.:|||
  Fly   286 -FQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGS 349

  Fly   210 DINLTCIAPQAPGPYTHMLWHKDTELV---SDSARGGIRVESEQQMKTSNLV--ISRVQH----- 264
            .::|.|       ..:...:.|:.:.:   :|||...::....:.....||:  :::.||     
  Fly   350 TVDLQC-------QISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQ 407

  Fly   265 ---------------------------------------------TDSGNYTCSADNSNSDSVFV 284
                                                         :|||||:||.....:..|.|
  Fly   408 DLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQV 472

  Fly   285 HIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVL 320
            .::..|..||:||.:|||..:..|.:|...::|:.|
  Fly   473 QVLTGELPAAVQHNIGSRTEIYSLAMLGHLLVLIFL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 5/18 (28%)
IG_like 98..179 CDD:214653 33/84 (39%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 4/7 (57%)
CDR1 114..120 CDD:409355 2/5 (40%)
FR2 121..132 CDD:409355 3/12 (25%)
Ig strand C 121..127 CDD:409355 2/5 (40%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 6/12 (50%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 10/28 (36%)
Ig strand E 155..162 CDD:409355 2/6 (33%)
Ig strand F 170..177 CDD:409355 5/6 (83%)
IG_like 206..278 CDD:214653 20/126 (16%)
Ig strand B 211..215 CDD:409353 1/3 (33%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 2/5 (40%)
Ig strand F 269..274 CDD:409353 3/4 (75%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 33/83 (40%)
Ig strand B 242..246 CDD:409433 2/3 (67%)
Ig strand C 255..264 CDD:409433 3/8 (38%)
Ig strand E 292..296 CDD:409433 2/3 (67%)
Ig strand F 306..311 CDD:409433 3/4 (75%)
Ig <417..474 CDD:472250 9/56 (16%)

Return to query results.
Submit another query.