DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:213 Identity:56/213 - (26%)
Similarity:90/213 - (42%) Gaps:27/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSV 164
            |..::|..|.:.|.|.:|....|:|:|.....||:|.....:.:.|....:.|:. .|.|.|..|
  Fly    83 VTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHR-SWYLHIKEV 146

  Fly   165 QQRDAGVYECQVSTEPKISLAYKLVVVTSKAQI--LANRELFIQSGSDINLTCIAPQAPGPYTHM 227
            ::.|.|.|.|||:|:|..|....|.||.....:  |.:.::.::.|.:|:|.|.|...|.||  :
  Fly   147 EETDRGWYMCQVNTDPMRSRKGYLQVVV
PPIIVEGLTSNDMVVREGQNISLVCKARGYPEPY--V 209

  Fly   228 LWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVF--VHIIKSE 290
            :|.::     |.....|..|....:....|.|::|.......|.|.|.|....|:.  ||:    
  Fly   210 MWRRE-----DGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHL---- 265

  Fly   291 QHAAMQHELGSRLLLPPL 308
                       |:..||:
  Fly   266 -----------RVQFPPM 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 28/90 (31%)
IG_like 98..179 CDD:214653 24/78 (31%)
IG_like 206..278 CDD:214653 19/71 (27%)
Ig 211..278 CDD:143165 18/66 (27%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 28/89 (31%)
IG_like 82..174 CDD:214653 29/91 (32%)
IG_like 184..267 CDD:214653 22/104 (21%)
IGc2 191..255 CDD:197706 19/70 (27%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.