DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr14

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:247 Identity:84/247 - (34%)
Similarity:133/247 - (53%) Gaps:12/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PVF-DNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQR--DLHILTIGIMTYTNDQRFLARHI 151
            |.| |..|...:...|.::..|||||..|..:.|||:|:|  ||.::|.|..||:.|.|: :...
  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRY-SLEF 136

  Fly   152 DNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANR-----ELFIQSGSDI 211
            :..::|.|.|....:||.|.||||||:.|.:.|...|.::....:||..|     |.:.::||.|
  Fly   137 EEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTI 201

  Fly   212 NLTCIAPQAPGPYTHMLWHKDTELVS-DSARGGIRVESEQ--QMKTSNLVISRVQHTDSGNYTCS 273
            .|.|:..:.|.|.:::.|.....|:: |::||||.|:::.  ....|.|.|:.....|:|||||.
  Fly   202 ELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCM 266

  Fly   274 ADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLLGPTS 325
            ..|..:::|.||::..|:.|||||..|||.......:::|.::.|.:.|..|
  Fly   267 LGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVCISGSIS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 4/16 (25%)
IG_like 98..179 CDD:214653 32/82 (39%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 3/7 (43%)
CDR1 114..120 CDD:409355 2/5 (40%)
FR2 121..132 CDD:409355 7/12 (58%)
Ig strand C 121..127 CDD:409355 3/5 (60%)
Ig strand C' 130..133 CDD:409355 1/2 (50%)
CDR2 133..146 CDD:409355 5/12 (42%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 9/28 (32%)
Ig strand E 155..162 CDD:409355 2/6 (33%)
Ig strand F 170..177 CDD:409355 5/6 (83%)
IG_like 206..278 CDD:214653 25/74 (34%)
Ig strand B 211..215 CDD:409353 2/3 (67%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 2/3 (67%)
Ig strand F 269..274 CDD:409353 4/4 (100%)
dpr14NP_572419.1 Ig 81..175 CDD:472250 35/94 (37%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 2/3 (67%)
Ig strand E 142..146 CDD:409353 2/3 (67%)
Ig strand F 156..161 CDD:409353 3/4 (75%)
Ig strand G 168..171 CDD:409353 1/2 (50%)
IG_like 191..279 CDD:214653 28/87 (32%)
Ig strand B 201..205 CDD:409473 2/3 (67%)
Ig strand C 214..220 CDD:409473 0/5 (0%)
Ig strand E 248..252 CDD:409473 2/3 (67%)
Ig strand F 262..267 CDD:409473 4/4 (100%)

Return to query results.
Submit another query.