Sequence 1: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038938277.1 | Gene: | Jaml / 315610 | RGDID: | 1562572 | Length: | 379 | Species: | Rattus norvegicus |
Alignment Length: | 297 | Identity: | 61/297 - (20%) |
---|---|---|---|
Similarity: | 117/297 - (39%) | Gaps: | 83/297 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 VIAALG--------TTARLHCRVRHLGDRA----------------VSWIRQRDLHI-------- 132
Fly 133 ---LTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSK 194
Fly 195 AQILAN--RELFIQSGSDINLTC-IAPQAPGPYTHMLW------HKDTELV--------SDSARG 242
Fly 243 GIRVESEQQM------KTSNLVISRVQHTDSGNYTCSADNSNSDS---VFVHIIKSE-------- 290
Fly 291 -QHAAMQHEL--GSRLL----LPPLPLLLLAVLLVVL 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr5 | NP_650080.3 | V-set | 95..191 | CDD:284989 | 26/125 (21%) |
IG_like | 98..179 | CDD:214653 | 23/113 (20%) | ||
IG_like | 206..278 | CDD:214653 | 18/92 (20%) | ||
Ig | 211..278 | CDD:143165 | 17/87 (20%) | ||
Jaml | XP_038938277.1 | V-set | 33..139 | CDD:400157 | 22/112 (20%) |
FR2 | 58..69 | CDD:409353 | 3/10 (30%) | ||
CDR2 | 70..82 | CDD:409353 | 1/11 (9%) | ||
Ig strand C' | 71..77 | CDD:409353 | 0/5 (0%) | ||
Ig strand C' | 78..82 | CDD:409353 | 1/3 (33%) | ||
FR3 | 87..121 | CDD:409353 | 10/35 (29%) | ||
Ig strand D | 90..96 | CDD:409353 | 1/5 (20%) | ||
Ig strand E | 100..108 | CDD:409353 | 2/9 (22%) | ||
Ig strand F | 115..122 | CDD:409353 | 3/6 (50%) | ||
V-set | 141..253 | CDD:400157 | 21/111 (19%) | ||
Ig strand A' | 144..150 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 152..162 | CDD:409353 | 2/9 (22%) | ||
CDR1 | 162..169 | CDD:409353 | 0/6 (0%) | ||
Ig strand C | 169..176 | CDD:409353 | 2/6 (33%) | ||
FR2 | 170..181 | CDD:409353 | 1/10 (10%) | ||
CDR2 | 182..196 | CDD:409353 | 2/13 (15%) | ||
Ig strand C' | 183..189 | CDD:409353 | 2/5 (40%) | ||
Ig strand C' | 191..196 | CDD:409353 | 0/4 (0%) | ||
FR3 | 204..238 | CDD:409353 | 6/33 (18%) | ||
Ig strand D | 207..213 | CDD:409353 | 0/5 (0%) | ||
Ig strand E | 217..225 | CDD:409353 | 0/7 (0%) | ||
Ig strand F | 232..238 | CDD:409353 | 4/5 (80%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 48 | 1.000 | Inparanoid score | I5388 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |