DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and DIP-alpha

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:110/268 - (41%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQ 127
            |:.:...||.....|...|    .|..|.|..:.. .|..|:|..|...|.|||||...|.|::.
  Fly    19 RNGKMLIHLLLIVSLLEAI----GAFQPEFVESIS-NVSVAVGRDATFTCHVRHLGGYRVGWLKA 78

  Fly   128 RDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEP-KISLAYKLVVV 191
            ....|..|.....|::.|....|:| .:.|.|.|.:|.:.|.|.|.||::|:| |..:.:..||:
  Fly    79 DTKAIQAIHENVITHNPRVTVSHLD-QNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVI 142

  Fly   192 --------TSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKD------------TELV 236
                    ||.       ::.:..||.:.|||.|...|.|.  :.|.::            |:.:
  Fly   143 PPDFISEDTSS-------DVIVPEGSSVRLTCRARGYPEPI--VTWRREDGNEIVLKDNVGTKTL 198

  Fly   237 SDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHI-IKSEQHAAMQHELG 300
            :.|.||.:            |.:|::...:.|:|.|.|.|....||...| :....|..:|  :.
  Fly   199 APSFRGEV------------LKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQ--VP 249

  Fly   301 SRLLLPPL 308
            ::|:..||
  Fly   250 NQLVGAPL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 31/96 (32%)
IG_like 98..179 CDD:214653 27/80 (34%)
IG_like 206..278 CDD:214653 20/83 (24%)
Ig 211..278 CDD:143165 18/78 (23%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 27/81 (33%)
Ig 51..131 CDD:299845 28/80 (35%)
I-set 144..240 CDD:254352 25/116 (22%)
IGc2 159..228 CDD:197706 20/82 (24%)
Ig 244..337 CDD:299845 4/16 (25%)
I-set 244..337 CDD:254352 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.