DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and rst

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:246 Identity:46/246 - (18%)
Similarity:84/246 - (34%) Gaps:72/246 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 AALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQ 166
            |.:|:...|.|.|.......:.||:.....:    :.|.||                 ...||..
  Fly   357 ADVGSVVSLTCEVDSNPQPEIVWIQHPSDRV----VGTSTN-----------------LTFSVSN 400

  Fly   167 RDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQS--------------GSDINLTCIA 217
            ..||.|.|:.:             |...|:|.|:..::::.              |....:.|.|
  Fly   401 ETAGRYYCKAN-------------VPGYAEISADAYVY
LKGSPAIGSQRTQYGLVGDTARIECFA 452

  Fly   218 PQAPGPYTHMLW------------HKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNY 270
            ...|.. .|:.|            | |..::.|:..||::         |.|:|...|....|.|
  Fly   453 SSVPRA-RHVSWTFNGQEISSESGH-DYSILVDAVPGGVK---------STLIIRDSQAYHYGKY 506

  Fly   271 TCSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLL 321
            .|:..|...:.|....:::::..::...:...:.:... ||:|.:|:||.:
  Fly   507 NCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAF-LLVLTILVVVYI 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 16/88 (18%)
IG_like 98..179 CDD:214653 16/76 (21%)
IG_like 206..278 CDD:214653 19/97 (20%)
Ig 211..278 CDD:143165 18/78 (23%)
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638
I-set 346..420 CDD:254352 19/96 (20%)
Ig 360..425 CDD:299845 19/98 (19%)
Ig5_KIRREL3-like 428..524 CDD:143235 20/106 (19%)
IG_like 435..524 CDD:214653 20/99 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.