DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Kirrel1

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:166 Identity:43/166 - (25%)
Similarity:70/166 - (42%) Gaps:35/166 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GIMTYTNDQRFLA-----------RHIDNSD--EWVLKIVSVQQRDAGVYECQVSTEPKISLAYK 187
            ||:.:|.|...|.           |.:.::|  ::.|:|...:..|...||||.:.....|...|
  Rat    81 GIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAK 145

  Fly   188 LVVV--TSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKD----------TELVSDSA 240
            |.|:  ....:|.....:.:|:|:..||||.|..|. |...::|.:|          |||:.|..
  Rat   146 LTV
LIPPEDTRIDGGPVILLQAGTPYNLTCRAFNAK-PAATIIWFRDGTQQEGAVTSTELLKDGK 209

  Fly   241 RGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADN 276
            |.  ...|:..::.::|.|.||       :||.:.|
  Rat   210 RE--TTISQLLIQPTDLDIGRV-------FTCRSMN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 17/67 (25%)
IG_like 98..179 CDD:214653 14/55 (25%)
IG_like 206..278 CDD:214653 24/81 (30%)
Ig 211..278 CDD:143165 22/76 (29%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 17/66 (26%)
Ig 57..148 CDD:299845 17/66 (26%)
Ig2_KIRREL3-like 170..251 CDD:143236 22/77 (29%)
I-set 255..336 CDD:254352
Ig_2 259..337 CDD:290606
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.