DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr1

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:232 Identity:106/232 - (45%)
Similarity:136/232 - (58%) Gaps:16/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTN 142
            |||:        |.||....|.:...:|.|..|||||..|||:.|||||:|||||||.|..|||:
  Fly    49 SNLL--------PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTS 105

  Fly   143 DQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQS 207
            ||||.....|.|..|.|:|...|.||:||||||::||||:||:|...||..||:|....:|.:::
  Fly   106 DQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKT 170

  Fly   208 GSDINLTCIAPQAPGPYTHMLWHKDTELVS-------DSARGGIRVESE-QQMKTSNLVISRVQH 264
            ||||||||...|.|....::.|:|.:|::.       ||:...||||.: ....||.|.|.|...
  Fly   171 GSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMP 235

  Fly   265 TDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGS 301
            .|:|||||....:.:.||:||:|..|..|||||...|
  Fly   236 GDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 5/16 (31%)
IG_like 98..179 CDD:214653 45/80 (56%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 4/7 (57%)
CDR1 114..120 CDD:409355 3/5 (60%)
FR2 121..132 CDD:409355 8/10 (80%)
Ig strand C 121..127 CDD:409355 4/5 (80%)
Ig strand C' 130..133 CDD:409355 2/2 (100%)
CDR2 133..146 CDD:409355 8/12 (67%)
Ig strand D 146..151 CDD:409355 1/4 (25%)
FR3 147..176 CDD:409355 13/28 (46%)
Ig strand E 155..162 CDD:409355 2/6 (33%)
Ig strand F 170..177 CDD:409355 6/6 (100%)
IG_like 206..278 CDD:214653 30/79 (38%)
Ig strand B 211..215 CDD:409353 3/3 (100%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 2/3 (67%)
Ig strand F 269..274 CDD:409353 4/4 (100%)
dpr1NP_995908.2 Ig 53..138 CDD:472250 46/84 (55%)
Ig strand A' 63..65 CDD:409355 0/1 (0%)
Ig strand B 69..77 CDD:409355 4/7 (57%)
CDR1 77..83 CDD:409355 3/5 (60%)
Ig strand C 84..90 CDD:409355 4/5 (80%)
CDR2 93..109 CDD:409355 11/15 (73%)
Ig strand D 109..114 CDD:409355 1/4 (25%)
FR3 110..147 CDD:409355 18/36 (50%)
Ig strand E 119..125 CDD:409355 2/5 (40%)
Ig strand F 133..148 CDD:409355 11/14 (79%)
CDR3 148..160 CDD:409355 5/11 (45%)
IG_like 163..257 CDD:214653 34/93 (37%)
Ig strand B 174..178 CDD:409355 3/3 (100%)
Ig strand C 189..193 CDD:409355 0/3 (0%)
Ig strand E 226..230 CDD:409355 2/3 (67%)
Ig strand F 240..244 CDD:409355 3/3 (100%)

Return to query results.
Submit another query.