DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and dpr9

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:322 Identity:114/322 - (35%)
Similarity:170/322 - (52%) Gaps:39/322 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IMGL-TAPVDKQSRRSSQYF-GHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHC 112
            |.|: ::.:.|.|..||..| ..||:....:::..:......|.||....:.|.|.||.||.|:|
  Fly   214 ITGIPSSSLHKASSASSNTFSSQLASGFHRNSIDLEEARNAGPYFDKAFSKNVTALLGKTAYLNC 278

  Fly   113 RVRHLGDRA----VSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYE 173
            ||::||::.    |||:|.||:|:||:|..|||:||||.|.|...:::|:|:|...|.||:|:||
  Fly   279 RVKNLGNKTMLLQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYE 343

  Fly   174 CQVSTEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVS- 237
            |||||.|.:|....|.||....:|:...:|:|:|||.||||||...:|.|..::.|:.:....| 
  Fly   344 CQVSTTPHMSHYIHLNVVEPSTEIIGAPDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSH 408

  Fly   238 ------DSARGGIRVESEQ-QMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAA- 294
                  ||.|||:.|.:.: ...||.|:|...:.:|||:|.|:..|:...||.||::....|:. 
  Fly   409 PQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVSHSVS 473

  Fly   295 -----------------MQHELGSRLLLPPLPLLLLAVL--LVVLLGPTSSLQIRTPL-STR 336
                             :.|.|.  :.:|...||.|...  :..|||  ::|....|| |||
  Fly   474 RGVPSSNAARGTSASSPLAHSLS--VCVPVCVLLQLGACRWIAALLG--AALATPPPLRSTR 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 48/99 (48%)
IG_like 98..179 CDD:214653 44/84 (52%)
IG_like 206..278 CDD:214653 29/79 (37%)
Ig 211..278 CDD:143165 26/74 (35%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 48/97 (49%)
IG_like 263..360 CDD:214653 48/96 (50%)
IG_like 371..464 CDD:214653 34/92 (37%)
IGc2 377..456 CDD:197706 29/78 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444740
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.