DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Jaml

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006510445.4 Gene:Jaml / 270152 MGIID:2685484 Length:405 Species:Mus musculus


Alignment Length:267 Identity:51/267 - (19%)
Similarity:101/267 - (37%) Gaps:65/267 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LGTTARLHCRVRHLGDR---AVSWIRQRDLHILTIGIMTYTND-----QRFLAR--------HID 152
            :|.:..:.|.|:...::   .|.|:..:|....:..::.|.::     .||..|        |.|
Mouse    63 VGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHND 127

  Fly   153 NSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILAN--RELFIQSGSDINLTC 215
            .|    |.:..||:.|.|:|.|::..:.:..:..|.|    :..:|..  ::|.::.|....:.|
Mouse   128 GS----LLLQDVQKADEGIYTCEIRLKNESMVMKKPV----ELWVL
PEEPKDLRVRVGDTTQMRC 184

  Fly   216 -IAPQAPGPYTHMLW------HKDTELV---SDSARGG-----------IRVESEQQMKTSNLVI 259
             |........|.:.|      |.:.|.|   ..:.|.|           :.:..:......::.:
Mouse   185 SIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKL 249

  Fly   260 SRVQHTDSGNYTCSADNSNSDS---VFVHIIKSEQHAAMQHELGSRLLLPPLPL------LLLAV 315
            ..|:.:|.|.||||......:|   :.:|:::.|         ..|.:.|..|.      :|...
Mouse   250 QTVKESDQGIYTCSIYVGKLESRKTIVLHVVQDE---------FQRTISPTPPTDKGQQGILNGN 305

  Fly   316 LLVVLLG 322
            .||:::|
Mouse   306 QLVIIVG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 22/102 (22%)
IG_like 98..179 CDD:214653 20/90 (22%)
IG_like 206..278 CDD:214653 17/92 (18%)
Ig 211..278 CDD:143165 16/87 (18%)
JamlXP_006510445.4 V-set 55..165 CDD:369466 22/109 (20%)
V-set 167..280 CDD:369466 20/112 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.