DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Lsamp

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:340 Identity:72/340 - (21%)
Similarity:118/340 - (34%) Gaps:131/340 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHID----N 153
            ||.|.|:     |.||.|.|.|.....: |:|:.:.       ||:...:|:..|...::    :
Mouse    70 DNITVRQ-----GDTAILRCVVEDKNSK-VAWLNRS-------GIIFAGHDKWSLDPRVELEKRH 121

  Fly   154 SDEWVLKIVSVQQRDAGVYECQVST--EPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCI 216
            :.|:.|:|..|...|.|.|.|.|.|  |||.|..|.:|.|..|...::: ::.:..||::.|.|:
Mouse   122 ALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISS-DVTVNEGSNVTLVCM 185

  Fly   217 APQAPGP-------------------YTHML---------------------------------- 228
            |...|.|                   |..:|                                  
Mouse   186 ANGRPEPVITWRHLTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPP 250

  Fly   229 -------------------------------WHKDTELVSDSARGGIRVESEQQMKTSNLVISRV 262
                                           |::|...::.:  .|:.::|.:..  |:|.::.|
Mouse   251 TITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSA--NGLEIKSTEGQ--SSLTVTNV 311

  Fly   263 QHTDSGNYTCSADN----SNSDSV-FVHIIKSEQHAAMQHELGSRLLLPP--------------- 307
            .....|||||.|.|    :|:..| |..::.:..|..  .|:|:.:...|               
Mouse   312 TEEHYGNYTCVAANKLGVTNASLVLFKRVLPTVPHPI--QEIGTTVHFKPKGPGSVRGINGSVSL 374

  Fly   308 -LPLLLLAVLLVVLL 321
             :||.|||..|..||
Mouse   375 AVPLWLLAASLFCLL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 30/101 (30%)
IG_like 98..179 CDD:214653 23/86 (27%)
IG_like 206..278 CDD:214653 23/159 (14%)
Ig 211..278 CDD:143165 21/154 (14%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 31/101 (31%)
Ig_3 163..232 CDD:372822 10/69 (14%)
Ig_3 250..325 CDD:372822 13/78 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.