DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dpr5 and LRIT1

DIOPT Version :9

Sequence 1:	NP_650080.3	Gene:	dpr5 / 41381	FlyBaseID:	FBgn0037908	Length:	336	Species:	Drosophila melanogaster
Sequence 2:	NP_056428.1	Gene:	LRIT1 / 26103	HGNCID:	23404	Length:	623	Species:	Homo sapiens

Alignment Length:	93	Identity:	27/93 - (29%)
Similarity:	39/93 - (41%)	Gaps:	9/93 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   208 GSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVE-SEQQMKTSNLVISRVQHTDSGNYT 271
            |....|.|.|...|||  .|.|.:..   .....|.:..| |......:.|.:..|.|.|||:|.
Human   268 GGTALLRCGATGVPGP--EMSWRRAN---GRPLNGTVHQEVSSDGTSWTLLGLPAVSHLDSGDYI 327

  Fly   272 CSADN--SNSDSVFVHIIKSEQHAAMQH 297
            |.|.|  ..|::| :.:|.:|...:.:|
Human   328 CQAKNFLGASETV-ISLIVTEPPTSTEH 354

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dpr5	NP_650080.3	V-set	95..191	CDD:284989
		IG_like	98..179	CDD:214653
		IG_like	206..278	CDD:214653	22/72 (31%)
		Ig	211..278	CDD:143165	21/69 (30%)
LRIT1	NP_056428.1	LRR 1	60..81
		leucine-rich repeat	61..84	CDD:275378
		LRR_8	63..143	CDD:290566
		LRR 2	84..105
		leucine-rich repeat	85..132	CDD:275378
		LRR 3	108..129
		LRR_8	131..202	CDD:290566
		LRR_4	131..171	CDD:289563
		LRR 4	132..153
		leucine-rich repeat	133..156	CDD:275378
		LRR 5	156..177
		leucine-rich repeat	157..180	CDD:275378
		leucine-rich repeat	181..205	CDD:275378
		TPKR_C2	201..>240	CDD:301599
		Ig	267..345	CDD:299845	24/82 (29%)
		IG_like	267..345	CDD:214653	24/82 (29%)
		FN3	431..498	CDD:214495
		LRR 6. /evidence=ECO:0000305	571..594
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900