DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Cadm4

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_694752.1 Gene:Cadm4 / 260299 MGIID:2449088 Length:388 Species:Mus musculus


Alignment Length:184 Identity:45/184 - (24%)
Similarity:80/184 - (43%) Gaps:19/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSV 164
            |..|.|..|.:.||: |..|.::..|:......|.........|:||      ..:|:..:.|.:
Mouse    32 VTVAEGGVAEITCRL-HQYDGSIVVIQNPARQTLFFNGTRALKDERF------QLEEFSPRRVRI 89

  Fly   165 QQRDA-----GVYECQVSTE-PKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGP 223
            :..||     |.|.||:.|| ....:|...|:|..:..::..||..:: |.::.|:|:.|:: .|
Mouse    90 RLSDARLEDEGGYFCQLYTEDTHHQIATLTV
LVAPENPVVEVREQAVE-GGEVELSCLVPRS-RP 152

  Fly   224 YTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYT-CSADN 276
            ...:.|::|.:.:...:.|   .|:.:....::.|..||...|.|... |.|.|
Mouse   153 AAVLRWYRDRKELKGVSSG---QENGKVWSVASTVRFRVDRKDDGGIVICEAQN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 4/12 (33%)
IG_like 98..179 CDD:214653 21/83 (25%)
Ig strand A' 100..102 CDD:409355 1/1 (100%)
Ig strand B 106..114 CDD:409355 2/7 (29%)
CDR1 114..120 CDD:409355 1/5 (20%)
FR2 121..132 CDD:409355 1/10 (10%)
Ig strand C 121..127 CDD:409355 1/5 (20%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 2/12 (17%)
Ig strand D 146..151 CDD:409355 1/4 (25%)
FR3 147..176 CDD:409355 7/33 (21%)
Ig strand E 155..162 CDD:409355 1/6 (17%)
Ig strand F 170..177 CDD:409355 4/6 (67%)
IG_like 206..278 CDD:214653 17/72 (24%)
Ig strand B 211..215 CDD:409353 1/3 (33%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 0/3 (0%)
Ig strand F 269..274 CDD:409353 1/5 (20%)
Cadm4NP_694752.1 Ig 29..120 CDD:472250 24/94 (26%)
Ig strand B 40..44 CDD:409465 1/3 (33%)
Ig strand C 53..57 CDD:409465 0/3 (0%)
Ig strand E 87..91 CDD:409465 1/3 (33%)
Ig strand F 101..106 CDD:409465 2/4 (50%)
Ig strand G 113..116 CDD:409465 0/2 (0%)
IgI_2_Necl-4 121..220 CDD:409468 20/88 (23%)
Ig strand A 121..124 CDD:409468 1/2 (50%)
Ig strand A' 127..131 CDD:409468 0/3 (0%)
Ig strand B 139..149 CDD:409468 2/9 (22%)
Ig strand C 152..161 CDD:409468 2/8 (25%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 1/9 (11%)
Ig strand E 177..187 CDD:409468 1/9 (11%)
Ig strand F 195..203 CDD:409468 2/7 (29%)
Ig strand G 212..219 CDD:409468
Ig_3 224..295 CDD:464046
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.