| Sequence 1: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_694752.1 | Gene: | Cadm4 / 260299 | MGIID: | 2449088 | Length: | 388 | Species: | Mus musculus |
| Alignment Length: | 184 | Identity: | 45/184 - (24%) |
|---|---|---|---|
| Similarity: | 80/184 - (43%) | Gaps: | 19/184 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 100 VIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSV 164
Fly 165 QQRDA-----GVYECQVSTE-PKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGP 223
Fly 224 YTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYT-CSADN 276 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr5 | NP_650080.3 | FR1 | 96..113 | CDD:409355 | 4/12 (33%) |
| IG_like | 98..179 | CDD:214653 | 21/83 (25%) | ||
| Ig strand A' | 100..102 | CDD:409355 | 1/1 (100%) | ||
| Ig strand B | 106..114 | CDD:409355 | 2/7 (29%) | ||
| CDR1 | 114..120 | CDD:409355 | 1/5 (20%) | ||
| FR2 | 121..132 | CDD:409355 | 1/10 (10%) | ||
| Ig strand C | 121..127 | CDD:409355 | 1/5 (20%) | ||
| Ig strand C' | 130..133 | CDD:409355 | 0/2 (0%) | ||
| CDR2 | 133..146 | CDD:409355 | 2/12 (17%) | ||
| Ig strand D | 146..151 | CDD:409355 | 1/4 (25%) | ||
| FR3 | 147..176 | CDD:409355 | 7/33 (21%) | ||
| Ig strand E | 155..162 | CDD:409355 | 1/6 (17%) | ||
| Ig strand F | 170..177 | CDD:409355 | 4/6 (67%) | ||
| IG_like | 206..278 | CDD:214653 | 17/72 (24%) | ||
| Ig strand B | 211..215 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 226..230 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 255..259 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 269..274 | CDD:409353 | 1/5 (20%) | ||
| Cadm4 | NP_694752.1 | Ig | 29..120 | CDD:472250 | 24/94 (26%) |
| Ig strand B | 40..44 | CDD:409465 | 1/3 (33%) | ||
| Ig strand C | 53..57 | CDD:409465 | 0/3 (0%) | ||
| Ig strand E | 87..91 | CDD:409465 | 1/3 (33%) | ||
| Ig strand F | 101..106 | CDD:409465 | 2/4 (50%) | ||
| Ig strand G | 113..116 | CDD:409465 | 0/2 (0%) | ||
| IgI_2_Necl-4 | 121..220 | CDD:409468 | 20/88 (23%) | ||
| Ig strand A | 121..124 | CDD:409468 | 1/2 (50%) | ||
| Ig strand A' | 127..131 | CDD:409468 | 0/3 (0%) | ||
| Ig strand B | 139..149 | CDD:409468 | 2/9 (22%) | ||
| Ig strand C | 152..161 | CDD:409468 | 2/8 (25%) | ||
| Ig strand C' | 162..165 | CDD:409468 | 0/2 (0%) | ||
| Ig strand D | 167..174 | CDD:409468 | 1/9 (11%) | ||
| Ig strand E | 177..187 | CDD:409468 | 1/9 (11%) | ||
| Ig strand F | 195..203 | CDD:409468 | 2/7 (29%) | ||
| Ig strand G | 212..219 | CDD:409468 | |||
| Ig_3 | 224..295 | CDD:464046 | |||
| 4.1m | 344..362 | CDD:128590 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||