DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and NEGR1

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:191 Identity:53/191 - (27%)
Similarity:85/191 - (44%) Gaps:30/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DNTTDREVIAALGTTARLHCRVRHLGDRAV--SWIRQRDLHILTIGIMTYTNDQRFLARHIDNSD 155
            ||...|:     |.||.|.|   :|.|.|.  :|:.:..  |:..|...::.|.|.....: |..
Human    46 DNMMVRK-----GDTAVLRC---YLEDGASKGAWLNRSS--IIFAGGDKWSVDPRVSISTL-NKR 99

  Fly   156 EWVLKIVSVQQRDAGVYECQVSTE--PKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAP 218
            ::.|:|.:|...|.|.|.|.|.|:  |:....:..|.|..|...::| ::.:..|:::.|||:|.
Human   100 DYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISN-DMTVNEGTNVTLTCLAT 163

  Fly   219 QAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNS 279
            ..|.|  .:.|..    :|.||:   ..|:.|.     |.|..:....:|.|.|||:|..|
Human   164 GKPEP--SISWRH----ISPSAK---PFENGQY-----LDIYGITRDQAGEYECSAENDVS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 26/99 (26%)
IG_like 98..179 CDD:214653 23/82 (28%)
IG_like 206..278 CDD:214653 21/71 (30%)
Ig 211..278 CDD:143165 20/66 (30%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 26/98 (27%)
IGc2 152..210 CDD:197706 21/71 (30%)
Ig_3 225..301 CDD:372822
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.