DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and NEGR1

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:191 Identity:53/191 - (27%)
Similarity:85/191 - (44%) Gaps:30/191 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DNTTDREVIAALGTTARLHCRVRHLGDRAV--SWIRQRDLHILTIGIMTYTNDQRFLARHIDNSD 155
            ||...|:     |.||.|.|   :|.|.|.  :|:.:..  |:..|...::.|.|.....: |..
Human    46 DNMMVRK-----GDTAVLRC---YLEDGASKGAWLNRSS--IIFAGGDKWSVDPRVSISTL-NKR 99

  Fly   156 EWVLKIVSVQQRDAGVYECQVSTE--PKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAP 218
            ::.|:|.:|...|.|.|.|.|.|:  |:....:..|.|..|...::| ::.:..|:::.|||:|.
Human   100 DYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISN-DMTVNEGTNVTLTCLAT 163

  Fly   219 QAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNS 279
            ..|.|  .:.|..    :|.||:   ..|:.|.     |.|..:....:|.|.|||:|..|
Human   164 GKPEP--SISWRH----ISPSAK---PFENGQY-----LDIYGITRDQAGEYECSAENDVS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 5/16 (31%)
IG_like 98..179 CDD:214653 23/82 (28%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 4/7 (57%)
CDR1 114..120 CDD:409355 1/5 (20%)
FR2 121..132 CDD:409355 2/12 (17%)
Ig strand C 121..127 CDD:409355 2/7 (29%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 2/12 (17%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 8/28 (29%)
Ig strand E 155..162 CDD:409355 1/6 (17%)
Ig strand F 170..177 CDD:409355 3/6 (50%)
IG_like 206..278 CDD:214653 21/71 (30%)
Ig strand B 211..215 CDD:409353 1/3 (33%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
NEGR1NP_776169.2 IG_like 47..135 CDD:214653 26/98 (27%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 68..72 CDD:409353 0/3 (0%)
Ig strand E 101..105 CDD:409353 1/3 (33%)
Ig strand F 115..120 CDD:409353 2/4 (50%)
Ig strand G 128..131 CDD:409353 0/2 (0%)
Ig_3 138..207 CDD:464046 22/83 (27%)
IG_like 231..312 CDD:214653
Ig strand B 241..245 CDD:409353
Ig strand C 254..258 CDD:409353
Ig strand E 280..284 CDD:409353
Ig strand F 294..299 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.