DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Tyro3

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_058788.1 Gene:Tyro3 / 25232 RGDID:3923 Length:880 Species:Rattus norvegicus


Alignment Length:252 Identity:52/252 - (20%)
Similarity:93/252 - (36%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWV--LKIVSVQQR 167
            |...:|:|.|..:.|..:.|::.        |.:.....|..::....|   |:  |.:.|.::.
  Rat    47 GQPVKLNCSVEGMDDPDIHWMKD--------GAVVQNASQVSISISEQN---WIGLLSLKSAERS 100

  Fly   168 DAGVYECQV--STEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWH 230
            |||:|.|||  ..|.|||.:..|.|.......:..::|.:.......|:|.|...|.|.|...|.
  Rat   101 DAGLYWCQVKDGEETKISQSVWLTV
EGVPFFTVEPKDLAVPPNVPFQLSCEAVGPPEPVTIFWWR 165

  Fly   231 KDTEL--------------VSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDS 281
            ..|::              |:..........:.:.:.||...|.|:|...:..:..:....:|.:
  Rat   166 GPTKVGGPASSPSVLNVTGVTQRTEFSCEAHNIKGLATSRPAIIRLQAPPAAPFNITVTTISSSN 230

  Fly   282 VFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVV--------LLGPTSSLQIR 330
            ..|..:......|:.|....::...|.....|||::.|        .|.|.::..:|
  Rat   231 ASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 24/89 (27%)
IG_like 98..179 CDD:214653 19/77 (25%)
IG_like 206..278 CDD:214653 14/85 (16%)
Ig 211..278 CDD:143165 14/80 (18%)
Tyro3NP_058788.1 IG_like 39..125 CDD:214653 24/88 (27%)
IGc2 46..111 CDD:197706 19/74 (26%)
Ig2_Tyro3_like 131..209 CDD:143226 12/77 (16%)
IG_like 135..204 CDD:214653 10/68 (15%)
FN3 215..307 CDD:238020 12/73 (16%)
fn3 315..396 CDD:278470
PTKc_Tyro3 498..781 CDD:270659
Pkinase_Tyr 508..776 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 804..827
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 842..864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.