DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and CADM1

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_016872946.1 Gene:CADM1 / 23705 HGNCID:5951 Length:477 Species:Homo sapiens


Alignment Length:257 Identity:63/257 - (24%)
Similarity:96/257 - (37%) Gaps:66/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 NTTDREVIAALGTTARLHCRVRHLGDRAVSWI---RQ----RDLHILTIGIMTYTNDQRFLARHI 151
            |...::|....|..|.:.|:|....|..:..:   ||    ||...|        .|.||...:.
Human    52 NLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPL--------KDSRFQLLNF 108

  Fly   152 DNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQ-------SGS 209
             :|.|..:.:.:|...|.|.|.||:.|:|. ..:|..:.|     ::..|.|.|.       .|.
Human   109 -SSSELKVSLTNVSISDEGRYFCQLYTDPP-QESYTTITV-----LVPPRNLMIDIQKDTAVEGE 166

  Fly   210 DINLTCIAPQAPGPYTHMLWHK-DTELVSDSARGGIRVE--SEQQMKTSNLVISRVQHTDSGNYT 271
            :|.:.|.| .|..|.|.:.|.| :|||     :|...||  |:....||.|:: :|...|.|   
Human   167 EIEVNCTA-MASKPATTIRWFKGNTEL-----KGKSEVEEWSDMYTVTSQLML-KVHKEDDG--- 221

  Fly   272 CSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLLGPTSSLQIRTPL 333
                        |.:|...:|.|:...|.::..|.            |...|...:|:..||
Human   222 ------------VPVICQVEHPAVTGNLQTQRYLE------------VQYKPQVHIQMTYPL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 25/102 (25%)
IG_like 98..179 CDD:214653 22/87 (25%)
IG_like 206..278 CDD:214653 22/81 (27%)
Ig 211..278 CDD:143165 21/69 (30%)
CADM1XP_016872946.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.