| Sequence 1: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001344522.1 | Gene: | Ntm / 235106 | MGIID: | 2446259 | Length: | 367 | Species: | Mus musculus |
| Alignment Length: | 345 | Identity: | 75/345 - (21%) |
|---|---|---|---|
| Similarity: | 121/345 - (35%) | Gaps: | 127/345 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 86 DAIDP-VFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLAR 149
Fly 150 HIDNSD-EWVLKIVSVQQRDAGVYECQVSTE--PKISLAYKLVVVTSKAQILANRELFIQSGSDI 211
Fly 212 NLTCIA--------------PQAPG---------------------------------------- 222
Fly 223 ------------------------------PYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNL 257
Fly 258 VISRVQHTDSGNYTCSADNS---NSDSVFVHIIKSEQHAAMQHELGSRLLLP---P--------- 307
Fly 308 ----------LPLLLLAVLL 317 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr5 | NP_650080.3 | V-set | 95..191 | CDD:284989 | 27/98 (28%) |
| IG_like | 98..179 | CDD:214653 | 21/81 (26%) | ||
| IG_like | 206..278 | CDD:214653 | 28/158 (18%) | ||
| Ig | 211..278 | CDD:143165 | 27/153 (18%) | ||
| Ntm | NP_001344522.1 | Ig | 44..132 | CDD:416386 | 27/97 (28%) |
| Ig strand A' | 44..49 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 59..63 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 64..70 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 64..70 | CDD:409353 | 3/6 (50%) | ||
| CDR2 | 71..83 | CDD:409353 | 3/13 (23%) | ||
| Ig strand C' | 72..76 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 84..118 | CDD:409353 | 9/35 (26%) | ||
| Ig strand D | 87..94 | CDD:409353 | 1/8 (13%) | ||
| Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 123..132 | CDD:409353 | 3/8 (38%) | ||
| FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
| Ig_3 | 136..205 | CDD:404760 | 12/69 (17%) | ||
| Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 151..160 | CDD:409353 | 5/8 (63%) | ||
| Ig strand F | 197..205 | CDD:409353 | 0/7 (0%) | ||
| Ig_3 | 222..299 | CDD:404760 | 17/79 (22%) | ||
| putative Ig strand A | 223..229 | CDD:409353 | 0/5 (0%) | ||
| Ig strand B | 239..243 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 252..256 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 278..282 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 292..297 | CDD:409353 | 4/4 (100%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||