DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Igsf9b

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:278 Identity:63/278 - (22%)
Similarity:100/278 - (35%) Gaps:65/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DKQSRRSSQYFGHLAAAEELSNLIPD-NYDAI------------DPVFDNTTDREVIAALGTTAR 109
            ||.|.|..|.........|...|:.| .||..            .|.|..|..:.:.|..|.:..
Mouse    96 DKASLRLEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTETPPQYIEAKEGGSIT 160

  Fly   110 LHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARH--IDNSDEWVLKIVSVQQRDAGVY 172
            :.|.........|:|:::..|    :|..         |::  .|.|    |.:.||.:.|.|.|
Mouse   161 MTCTAFGNPKPIVTWLKEGTL----LGAS---------AKYQVSDGS----LTVTSVSREDRGAY 208

  Fly   173 ECQVSTEPKISLAYKL---------VVVTSKAQILANRE-LFIQSGSDINLTCIAPQAPGPYTH- 226
            .|:         ||.:         ::|.....|::..| :.:....|..|||.|...||..|: 
Mouse   209 TCR---------AYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTCRAEAYPGNLTYT 264

  Fly   227 MLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQ 291
            ..|..:.....:..:..:|:     :....|:|.||:..|:|.|||...||...|.......:.|
Mouse   265 WYWQDENVYFQNDLKLRVRI-----LIDGTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTVQ 324

  Fly   292 HAAMQHELGSRLL-LPPL 308
            :.|       |:| :||:
Mouse   325 YPA-------RVLNMPPV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 20/106 (19%)
IG_like 98..179 CDD:214653 17/82 (21%)
IG_like 206..278 CDD:214653 20/72 (28%)
Ig 211..278 CDD:143165 19/67 (28%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273 6/20 (30%)
I-set 141..227 CDD:369462 22/111 (20%)
Ig 231..323 CDD:386229 24/96 (25%)
Ig <355..416 CDD:386229
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.