DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Iglon5

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:337 Identity:71/337 - (21%)
Similarity:121/337 - (35%) Gaps:123/337 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GHLAAAEELSNLIP-DNYDAIDPVFDNTTDREVIAALGTTARLHCRV-RHLGDRAVSWIRQRDLH 131
            |.|:.:.|.|:  | |||...:               |..|.|.|.: .|:  ..|:|:.:.  :
Mouse    27 GLLSQSLEFSS--PADNYTVCE---------------GDNATLSCFIDEHV--TRVAWLNRS--N 70

  Fly   132 ILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVST--EPKISLAYKLVVVTSK 194
            ||..|...:|:|.| :...|:..:|:.:.|..|...|.|:|.|...|  :|..:..|.:|.|.::
Mouse    71 ILYAGNDRWTSDPR-VRLLINTPEEFSILITQVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPAR 134

  Fly   195 AQILANRELFIQSGSDINLTCIAPQAPGP---------------------------------YTH 226
            . :..:..:.:..|.::||.|:|...|.|                                 .||
Mouse   135 I-VNISSPVAVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEILEISDIQRGQAGEYECVTH 198

  Fly   227 -------------------------------------------------MLWHKDTELVSDSARG 242
                                                             ..|:||..|:|..:..
Mouse   199 NGVNSAPDSRRVLVTVNYPPTITDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLSSGSAE 263

  Fly   243 GIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNS-NSDSVFVHIIK--SEQHAAMQHELGSRLL 304
            |::|::|:  ..|.|:.:.|.....|||||.|.|. .:.|..:.:::  |.:::|.:        
Mouse   264 GLKVQTER--TRSMLLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPR-------- 318

  Fly   305 LPPLPLLLLAVL 316
             ||.||.||:.|
Mouse   319 -PPGPLTLLSAL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 25/98 (26%)
IG_like 98..179 CDD:214653 22/83 (27%)
IG_like 206..278 CDD:214653 27/154 (18%)
Ig 211..278 CDD:143165 26/149 (17%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 26/107 (24%)
Ig strand A' 41..46 CDD:409353 2/4 (50%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 2/6 (33%)
Ig strand C 61..67 CDD:409353 2/5 (40%)
CDR2 69..79 CDD:409353 3/11 (27%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 11/35 (31%)
Ig strand D 84..91 CDD:409353 2/7 (29%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 2/8 (25%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A 132..137 CDD:409353 0/5 (0%)
Ig_3 134..199 CDD:404760 8/65 (12%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 0/4 (0%)
Ig strand F 191..199 CDD:409353 1/7 (14%)
Ig_3 217..295 CDD:404760 17/79 (22%)
putative Ig strand A 218..224 CDD:409353 0/5 (0%)
Ig strand B 234..238 CDD:409353 0/3 (0%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 4/4 (100%)
Ig strand G 301..304 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.