Sequence 1: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
Alignment Length: | 337 | Identity: | 71/337 - (21%) |
---|---|---|---|
Similarity: | 121/337 - (35%) | Gaps: | 123/337 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 GHLAAAEELSNLIP-DNYDAIDPVFDNTTDREVIAALGTTARLHCRV-RHLGDRAVSWIRQRDLH 131
Fly 132 ILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVST--EPKISLAYKLVVVTSK 194
Fly 195 AQILANRELFIQSGSDINLTCIAPQAPGP---------------------------------YTH 226
Fly 227 -------------------------------------------------MLWHKDTELVSDSARG 242
Fly 243 GIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNS-NSDSVFVHIIK--SEQHAAMQHELGSRLL 304
Fly 305 LPPLPLLLLAVL 316 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr5 | NP_650080.3 | V-set | 95..191 | CDD:284989 | 25/98 (26%) |
IG_like | 98..179 | CDD:214653 | 22/83 (27%) | ||
IG_like | 206..278 | CDD:214653 | 27/154 (18%) | ||
Ig | 211..278 | CDD:143165 | 26/149 (17%) | ||
Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 26/107 (24%) |
Ig strand A' | 41..46 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
FR2 | 61..68 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 61..67 | CDD:409353 | 2/5 (40%) | ||
CDR2 | 69..79 | CDD:409353 | 3/11 (27%) | ||
Ig strand C' | 71..74 | CDD:409353 | 2/2 (100%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 11/35 (31%) | ||
Ig strand D | 84..91 | CDD:409353 | 2/7 (29%) | ||
Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 120..129 | CDD:409353 | 2/8 (25%) | ||
FR4 | 122..129 | CDD:409353 | 1/6 (17%) | ||
Ig strand A | 132..137 | CDD:409353 | 0/5 (0%) | ||
Ig_3 | 134..199 | CDD:404760 | 8/65 (12%) | ||
Ig strand A' | 140..145 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 148..157 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 163..167 | CDD:409353 | 0/3 (0%) | ||
Ig strand D | 174..177 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 178..183 | CDD:409353 | 0/4 (0%) | ||
Ig strand F | 191..199 | CDD:409353 | 1/7 (14%) | ||
Ig_3 | 217..295 | CDD:404760 | 17/79 (22%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 0/5 (0%) | ||
Ig strand B | 234..238 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 288..293 | CDD:409353 | 4/4 (100%) | ||
Ig strand G | 301..304 | CDD:409353 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |