DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and zig-10

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:305 Identity:63/305 - (20%)
Similarity:107/305 - (35%) Gaps:85/305 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YFMALLVIMGLTAPVDKQSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTT 107
            |.:.||::|                   :|.:|.:..|.|           .....|.:..:|:|
 Worm     7 YLVLLLILM-------------------IALSETIHTLAP-----------KKAPTERLVPIGST 41

  Fly   108 ARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFL--ARHIDNSDEWV-----LKIVSVQ 165
            ..|.|......:  |:|  .||.|:    |.|....:..:  .|.....:|.:     |.|..||
 Worm    42 TALECEPYTSSN--VTW--YRDKHV----IATVEGHKNAILNERKPRGGEERIPEIGFLVIFDVQ 98

  Fly   166 QRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQS-----GSDINLTCIAPQA-PGPY 224
            :.|.|.|.||...:.|....::|.:.... :|..|.::.::.     |..:.|.|..|:| |.| 
 Worm    99 KEDEGNYYCQRENDSKWGEVFQLKIAYVD-EISQNEKIKLEPNVPTLGRSLVLHCPIPKAYPPP- 161

  Fly   225 THMLWHKDTELVSDSARGGIRVESEQ-QMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIK 288
             .:.|..::..:|       .:.|:. ......|:||...:...|.:.|:.:|...         
 Worm   162 -KVTWTVNSLPIS-------HISSDYVAFPNGTLIISHFSYHHFGYFECNINNFAG--------- 209

  Fly   289 SEQHAAMQHELGSRLLLPPLPLL-----------LLAVLLVVLLG 322
               ||:....:.||.|:..|..|           |.:.|.:.|||
 Worm   210 ---HASTNTFIDSRELVANLESLKPTFVNGCSAALRSSLFMFLLG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 25/102 (25%)
IG_like 98..179 CDD:214653 23/87 (26%)
IG_like 206..278 CDD:214653 16/78 (21%)
Ig 211..278 CDD:143165 15/68 (22%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 24/94 (26%)
IGc2 38..111 CDD:197706 22/80 (28%)
IG_like 143..215 CDD:214653 18/92 (20%)
IGc2 145..209 CDD:197706 16/72 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.