DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and zig-4

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:278 Identity:52/278 - (18%)
Similarity:89/278 - (32%) Gaps:102/278 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LLVIMGLTAPVDKQSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAAL------- 104
            |:|::....|:..:..         :|...|:|.|..||      ..:....:::|.|       
 Worm    10 LVVLINAHPPMHAEMH---------SAVVTLANEIDTNY------LTSPAKIKIVAPLESALIPG 59

  Fly   105 GTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEW------------ 157
            |.|.:|.|.:.......:.|                    :|..:.|..|:|.            
 Worm    60 GETYQLRCDIMSTPAATIHW--------------------KFNGKLIQGSNELNVEEKLLNFGKA 104

  Fly   158 ------VLKIVSVQ---QRDAGVYEC-------------QVSTEPKIS-------LAYKLVVVTS 193
                  |..|:::|   ..::|.|.|             :|..|.:.|       .|.::|..|.
 Worm   105 IVDTGIVASILTIQCPSAENSGTYSCVGYNGHQTIETVAEVEIEGEASGCRSNHKSAPEIVFWTD 169

  Fly   194 KAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLV 258
            ..        |..:|:...|.|.|.|    ....:|..:.|||.::.:..:       :...:||
 Worm   170 SR--------FEMTGNVATLVCRANQ----QVDWVWMSNDELVKNNDKFTV-------LSNGDLV 215

  Fly   259 ISRVQHTDSGNYTCSADN 276
            |..:...|.|.|||.|.|
 Worm   216 IKNIVWDDMGTYTCIARN 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 22/143 (15%)
IG_like 98..179 CDD:214653 18/121 (15%)
IG_like 206..278 CDD:214653 19/71 (27%)
Ig 211..278 CDD:143165 18/66 (27%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 18/119 (15%)
Ig 65..144 CDD:143165 13/98 (13%)
IG_like 176..245 CDD:214653 19/69 (28%)
Ig <193..238 CDD:299845 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.