DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Ncam1

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:235 Identity:48/235 - (20%)
Similarity:87/235 - (37%) Gaps:60/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQR 145
            :|....|...:.:.|      |.||.:..|.|......:..:||.:..:         ...|::.
Mouse   210 VPPTVQARQSIVNAT------ANLGQSVTLVCDADGFPEPTMSWTKDGE---------PIENEEE 259

  Fly   146 FLARHIDNSDEWVLKIVSVQQRDAGVYEC---------------QVSTEPKISLAYKLVVVTSKA 195
            ...:||.:.|...|.|.:|.:.|...|.|               :|..:|||:.......:..:.
Mouse   260 DDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKITYVENQTAMELEE 324

  Fly   196 QILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGG-IRVESEQQM------- 252
            |              :.|||.|...|.|  .:.|...|..:|...:.. .|.|.::.:       
Mouse   325 Q--------------VTLTCEASGDPIP--SITWRTSTRNISSEEKASWTRPEKQETLDGHMVVR 373

  Fly   253 ---KTSNLVISRVQHTDSGNYTCSADNS---NSDSVFVHI 286
               :.|:|.:..:|:||:|.|.|:|.|:   :|.|:::.:
Mouse   374 SHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEV 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 22/110 (20%)
IG_like 98..179 CDD:214653 18/95 (19%)
IG_like 206..278 CDD:214653 21/85 (25%)
Ig 211..278 CDD:143165 21/80 (26%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652
Ig3_NCAM-1_like 211..308 CDD:143207 21/111 (19%)
Ig_NCAM-1 307..413 CDD:143277 27/121 (22%)
Ig_3 417..494 CDD:372822
FN3 509..606 CDD:238020
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.