DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and zig-8

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:237 Identity:56/237 - (23%)
Similarity:104/237 - (43%) Gaps:27/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GHLAAAEELSNLIPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHIL 133
            ||.|:.|.::.|..:.....:|   :.|...|:|.  ..|.|||.|....:..::|.|..|..:|
 Worm    19 GHGASEEVMACLRQERSRVENP---SQTIVNVVAE--NPAYLHCSVPPDAEHEIAWTRVSDGALL 78

  Fly   134 TIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVV------- 191
            |.|..|:|.|.|:.... .:::.|||.:...:|:|:|.|.|:::.:.....|..|.|:       
 Worm    79 TAGNRTFTRDPRWQVSK-KSANIWVLNLRRAEQQDSGCYLCEINDKHNTVYAVYLKVLEPPLPSP 142

  Fly   192 ----TSKAQILANRELFIQSGSDINLTC--IAPQAPGPYTHMLWHKDTELV--SDSARGGIRVES 248
                ....:::||     .||.::.|.|  .:.........::|.:|...:  :|:.:..::|:.
 Worm   143 SSLQKKSTKLMAN-----MSGDEVVLNCTVTSTDKDEEVLDVVWTRDGNTINFNDTEKYILKVKR 202

  Fly   249 EQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSE 290
            :..:....:.|.:....|.|||.|......:..: |||.|:|
 Worm   203 DAGVVIETMRIRKATMEDDGNYACEHSQQKASQI-VHINKAE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 28/95 (29%)
IG_like 98..179 CDD:214653 25/80 (31%)
IG_like 206..278 CDD:214653 14/75 (19%)
Ig 211..278 CDD:143165 12/70 (17%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 24/79 (30%)
Ig 55..129 CDD:143165 22/74 (30%)
ig 158..229 CDD:278476 13/70 (19%)
IG_like 158..227 CDD:214653 12/68 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I7153
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28597
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.