Sequence 1: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001251131.1 | Gene: | rig-5 / 172791 | WormBaseID: | WBGene00004372 | Length: | 482 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 50/196 - (25%) |
---|---|---|---|
Similarity: | 86/196 - (43%) | Gaps: | 18/196 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 PVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIR-QRDLHILTIG--IMTYTNDQRFLARHI 151
Fly 152 DNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLA-----YKLVVVTSKAQILANRELFIQSGSDI 211
Fly 212 NLTCIAPQAPGPYTHMLWHK-DTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSAD 275
Fly 276 N 276 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr5 | NP_650080.3 | V-set | 95..191 | CDD:284989 | 30/103 (29%) |
IG_like | 98..179 | CDD:214653 | 24/83 (29%) | ||
IG_like | 206..278 | CDD:214653 | 16/72 (22%) | ||
Ig | 211..278 | CDD:143165 | 15/67 (22%) | ||
rig-5 | NP_001251131.1 | IG_like | 92..189 | CDD:214653 | 29/97 (30%) |
Ig_3 | 191..270 | CDD:372822 | 18/86 (21%) | ||
IG | 294..380 | CDD:214652 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |