DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and rig-5

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:196 Identity:50/196 - (25%)
Similarity:86/196 - (43%) Gaps:18/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIR-QRDLHILTIG--IMTYTNDQRFLARHI 151
            |.....:....:|.||......|.|..||...|:::: .....:|:..  :....|......|..
 Worm    84 PTIQQPSMSSAVALLGQDVDFTCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRNKYELKPRIG 148

  Fly   152 DNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLA-----YKLVVVTSKAQILANRELFIQSGSDI 211
            |..:||||.|.:||:.|.|.|.||::||| |:|:     .|:..|.|::...|   :.::.|:::
 Worm   149 DLHNEWVLTIKNVQESDRGNYSCQINTEP-ITLSTGELDVKVPPVVSRSTPAA---VEVREGNNV 209

  Fly   212 NLTCIAPQAPGPYTHMLWHK-DTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSAD 275
            :|||.|...|.|  .::|.: |.:::..:...|.   .........|.:::|.......|.|.|.
 Worm   210 SLTCKADGNPTP--TVIWRRQDRQIIRYNGATGF---GASVFHGPVLHLTKVSRKHMSEYLCVAS 269

  Fly   276 N 276
            |
 Worm   270 N 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 30/103 (29%)
IG_like 98..179 CDD:214653 24/83 (29%)
IG_like 206..278 CDD:214653 16/72 (22%)
Ig 211..278 CDD:143165 15/67 (22%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 29/97 (30%)
Ig_3 191..270 CDD:372822 18/86 (21%)
IG 294..380 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.