DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and LOC1282038

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_061500784.1 Gene:LOC1282038 / 1282038 VectorBaseID:AGAMI1_009918 Length:467 Species:Anopheles gambiae


Alignment Length:148 Identity:26/148 - (17%)
Similarity:55/148 - (37%) Gaps:41/148 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YECQVSTEPKISLAYKLVVVTSKAQILANRELFIQSGSDIN--LTCIAPQAPGPYTHMLWHKDTE 234
            ||.:.|.  .|.|.:.|:...|..|::.|..|....|..:.  ::.:|.|            :.:
Mosquito   347 YEARYSI--SIFLVWALIYKISLFQMIFNCHLLHAEGKRLGSIISYVASQ------------END 397

  Fly   235 LVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNS-----------NSDSVFVHIIK 288
            ::.              :|..:.::.::||......|.:.|.:           ...|:.:.:|.
Mosquito   398 VIC--------------IKKMHSLLCQIQHNPIKITTYTFDINLGVFFGVSLFQQITSIDLTLIF 448

  Fly   289 SEQHAAMQHELGSRLLLP 306
            ..:.|::...|.:|||:|
Mosquito   449 LNRFASLSLSLRTRLLVP 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355
IG_like 98..179 CDD:214653 3/6 (50%)
Ig strand A' 100..102 CDD:409355
Ig strand B 106..114 CDD:409355
CDR1 114..120 CDD:409355
FR2 121..132 CDD:409355
Ig strand C 121..127 CDD:409355
Ig strand C' 130..133 CDD:409355
CDR2 133..146 CDD:409355
Ig strand D 146..151 CDD:409355
FR3 147..176 CDD:409355 2/3 (67%)
Ig strand E 155..162 CDD:409355
Ig strand F 170..177 CDD:409355 2/4 (50%)
IG_like 206..278 CDD:214653 8/84 (10%)
Ig strand B 211..215 CDD:409353 0/5 (0%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 0/3 (0%)
Ig strand F 269..274 CDD:409353 1/4 (25%)
LOC1282038XP_061500784.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.