DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and Opcml

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:199 Identity:55/199 - (27%)
Similarity:88/199 - (44%) Gaps:35/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DAIDP-VFDNTTDREVIAALGTTARLHCRVRHLGDRA--VSWIRQRDLHILTIGIMTYTNDQRFL 147
            ||..| ..||.|.|:     |.:|.|.|.:   .||.  |:|:.:..  ||..|...::.|.|.:
  Rat    35 DATFPKAMDNVTVRQ-----GESATLRCTI---DDRVTRVAWLNRST--ILYAGNDKWSIDPRVI 89

  Fly   148 ARHIDNSDEWVLKIVSVQQRDAGVYECQVSTE--PKISLAYKLVVVTSKAQILANRELFIQSGSD 210
            .. ::...::.:.|.:|...|.|.|.|.|.|:  ||.|..:.:|.|..:...::: ::.:..||.
  Rat    90 IL-VNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISS-DITVNEGSS 152

  Fly   211 INLTCIAPQAPGP---YTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTC 272
            :.|.|:|...|.|   :.|:           |.:.|....||.:.    |.||.::...||.|.|
  Rat   153 VTLLCLAIGRPEPTVTWRHL-----------SVKEGQGFVSEDEY----LEISDIKRDQSGEYEC 202

  Fly   273 SADN 276
            ||.|
  Rat   203 SALN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 5/16 (31%)
IG_like 98..179 CDD:214653 21/82 (26%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 3/7 (43%)
CDR1 114..120 CDD:409355 0/5 (0%)
FR2 121..132 CDD:409355 2/12 (17%)
Ig strand C 121..127 CDD:409355 2/7 (29%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 3/12 (25%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 6/28 (21%)
Ig strand E 155..162 CDD:409355 0/6 (0%)
Ig strand F 170..177 CDD:409355 3/6 (50%)
IG_like 206..278 CDD:214653 22/74 (30%)
Ig strand B 211..215 CDD:409353 1/3 (33%)
Ig strand C 226..230 CDD:409353 1/3 (33%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
OpcmlXP_017450901.1 Ig 44..132 CDD:472250 27/98 (28%)
Ig strand B 53..57 CDD:409353 2/3 (67%)
Ig strand C 65..69 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 135..206 CDD:464046 21/86 (24%)
Ig 224..312 CDD:472250
Ig strand B 240..244 CDD:409353
Ig strand C 253..257 CDD:409353
Ig strand E 279..283 CDD:409353
Ig strand F 293..298 CDD:409353
Ig strand G 306..309 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.