DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and cadm4

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_002939173.1 Gene:cadm4 / 100488420 XenbaseID:XB-GENE-992659 Length:394 Species:Xenopus tropicalis


Alignment Length:305 Identity:65/305 - (21%)
Similarity:109/305 - (35%) Gaps:83/305 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 APQIAHEMLVEYFMALLVIMGLTAPVDKQSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTT 96
            ||.:|  :|.:.|:..:|::.....|..|..::                            :|.|
 Frog     6 APALA--LLQQRFVLGIVLLATAGTVVSQEVQA----------------------------ENVT 40

  Fly    97 DREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKI 161
            ..|     |.||.:.|.: |..|.::..|:......|.........|.||      ...|:..|:
 Frog    41 VVE-----GGTAEISCHL-HQYDGSIVVIQNPVRQTLFFNGTRALKDTRF------QLVEFTQKV 93

  Fly   162 VSVQQRDA-----GVYECQVSTE-PKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQA 220
            |.:...||     |.|.||:.|| ....:|...|:|.....::..:|..:: |.:|.||||:|:.
 Frog    94 VKIHLSDAKLEDEGGYFCQLYTEDTHHQIATLTVIVPPDNPLVEVKEQAVE-GGEIELTCISPRT 157

  Fly   221 PGPYTHMLWHKD-TELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGN-YTCSADNSNSDSVF 283
             .|...:.|::| .||...::    :.|:.:....:|.:...|...|..: .||.|.        
 Frog   158 -RPAATLRWYRDRKELKGFTS----KQENGKTFSITNSIRFSVDRKDDRDIVTCEAS-------- 209

  Fly   284 VHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLLGPTSSLQ 328
             |.....|....|:||.                  |...||:::|
 Frog   210 -HPALKGQKKQTQYELD------------------VQFSPTANIQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 5/16 (31%)
IG_like 98..179 CDD:214653 21/85 (25%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 3/7 (43%)
CDR1 114..120 CDD:409355 1/5 (20%)
FR2 121..132 CDD:409355 1/10 (10%)
Ig strand C 121..127 CDD:409355 1/5 (20%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 2/12 (17%)
Ig strand D 146..151 CDD:409355 1/4 (25%)
FR3 147..176 CDD:409355 8/33 (24%)
Ig strand E 155..162 CDD:409355 2/6 (33%)
Ig strand F 170..177 CDD:409355 4/6 (67%)
IG_like 206..278 CDD:214653 19/73 (26%)
Ig strand B 211..215 CDD:409353 2/3 (67%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/5 (40%)
cadm4XP_002939173.1 IgI_2_Necl-4 128..226 CDD:409468 26/130 (20%)
Ig strand A 128..131 CDD:409468 1/2 (50%)
Ig strand A' 134..138 CDD:409468 0/3 (0%)
Ig strand B 146..156 CDD:409468 5/9 (56%)
Ig strand C 159..168 CDD:409468 2/8 (25%)
Ig strand C' 169..172 CDD:409468 0/2 (0%)
Ig strand D 174..181 CDD:409468 0/10 (0%)
Ig strand E 184..194 CDD:409468 1/9 (11%)
Ig strand F 202..210 CDD:409468 3/16 (19%)
Ig strand G 218..225 CDD:409468 2/6 (33%)
Ig_3 230..301 CDD:464046 3/6 (50%)
4.1m 350..368 CDD:128590
Ig 37..127 CDD:472250 26/101 (26%)
Ig strand B 47..51 CDD:409353 1/3 (33%)
Ig strand C 60..64 CDD:409353 0/3 (0%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 120..123 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.