DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and iglon5

DIOPT Version :10

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:378 Identity:84/378 - (22%)
Similarity:125/378 - (33%) Gaps:146/378 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LTAPVDKQSRRSSQYFGHLAAAEEL----SNLIP--DNYDAIDPVFDNTTDREVIAALGTTARLH 111
            :.||:.:.|..|   .|.:..|:.|    :..:|  |||               ..:.|..|.|.
 Frog     1 MKAPLQRVSLAS---LGIVMLAQVLFVQCTEFVPPADNY---------------TVSQGDNATLS 47

  Fly   112 CRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNS-DEWVLKIVSVQQRDAGVYECQ 175
            |.:.....| |:|:.:.  :||..|...::.|.|  .:.:.|: .|:.:.|..|...|.|:|.|.
 Frog    48 CLIDDKVTR-VAWLNRS--NILYAGKDKWSIDSR--VQLLTNTKSEYSIVITHVDVADEGLYTCS 107

  Fly   176 VSTE--PKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGP--------------- 223
            ..||  |..|..|.:|.|.:|. :..:..:.:..||::||.|:|...|.|               
 Frog   108 FQTEDKPHTSQVYLIVQVPAKI-VNISSSVTVNEGSNVNLQCLAVGKPEPTITWQQLSEGFSSEG 171

  Fly   224 -------------------------------------YTHML----------------------- 228
                                                 |...:                       
 Frog   172 ELLEITEINRQQAGDYECVTSNGVSVPDTKKVQITVNYPPYITDVKNAQSPVGRPATLRCKAMAV 236

  Fly   229 ------WHKDTELVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADNSNSDSVFVHII 287
                  |:||.:....|...|:.:::|...  |.:|.|.|.....|||||.|.|           
 Frog   237 PPAEFEWYKDEKRRLISGTEGLSIKTESSW--SVIVFSNVTSRHYGNYTCLASN----------- 288

  Fly   288 KSEQHAAMQHELGS-----RLLLPPLPLLLLAVLLV--VLLGPTSSLQIRTPL 333
                      :|||     |||.|..||...|..:|  :|||..||..|  ||
 Frog   289 ----------KLGSFNSSLRLLKPGDPLNQGATHMVSPLLLGLLSSTLI--PL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 FR1 96..113 CDD:409355 3/16 (19%)
IG_like 98..179 CDD:214653 20/81 (25%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 3/7 (43%)
CDR1 114..120 CDD:409355 0/5 (0%)
FR2 121..132 CDD:409355 2/10 (20%)
Ig strand C 121..127 CDD:409355 2/5 (40%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 3/12 (25%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 8/29 (28%)
Ig strand E 155..162 CDD:409355 1/6 (17%)
Ig strand F 170..177 CDD:409355 3/6 (50%)
IG_like 206..278 CDD:214653 26/152 (17%)
Ig strand B 211..215 CDD:409353 2/3 (67%)
Ig strand C 226..230 CDD:409353 0/32 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 4/4 (100%)
iglon5XP_002938252.1 Ig 31..123 CDD:472250 29/111 (26%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 2/4 (50%)
Ig strand E 89..93 CDD:409353 0/3 (0%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 1/2 (50%)
Ig 122..207 CDD:472250 11/85 (13%)
Ig strand B 144..148 CDD:409353 2/3 (67%)
Ig strand C 157..160 CDD:409353 0/2 (0%)
Ig strand E 172..176 CDD:409353 0/3 (0%)
Ig strand F 186..191 CDD:409353 0/4 (0%)
Ig strand G 200..203 CDD:409353 0/2 (0%)
Ig_3 210..288 CDD:464046 16/79 (20%)

Return to query results.
Submit another query.