DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and lrit3b

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:320 Identity:66/320 - (20%)
Similarity:112/320 - (35%) Gaps:116/320 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LTA-PVD----------KQSRRSSQYFGHLAAAEEL----------SNLIPDNYDAIDPVFDNTT 96
            ||| |:|          :::..|..:.|..:|..||          |.|.|.::..:..:.:...
Zfish    79 LTAIPIDLPNDTVKFRLERTSVSRIFRGAFSAMPELLYLWLTYNSISVLHPRSFTNLSSLHELRL 143

  Fly    97 DREVIAA-----------LGTTARLHCRVRHLGDRAVSWIRQ-RDLHILTIGIMTYTNDQRFLAR 149
            |..:::.           |.|....:.|:..:...||.::|. ..|.:.:..:.|..||...|..
Zfish   144 DGNLLSTFPWEGLRDMPRLRTLGLHNNRLARIPLLAVRYLRNVTYLDLSSNRLSTLANDLTALWL 208

  Fly   150 HIDNSD---EWVLKIVSVQQRDAGVYECQVST----------------------EP--------- 180
            ..|::.   .:||.:    |.:..|.:|::||                      ||         
Zfish   209 FSDSNQTQRSFVLGL----QDNPWVCDCRLSTLLDISRGPESSLVLLDRFLTCSEPLDLAGVPFQ 269

  Fly   181 --KISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHK------------ 231
              ::|...:..||||..:|.|      ..||.:.|.|.|...|.|  .::|.|            
Zfish   270 SVELSRCRRPYVVTSATKITA------LLGSTVLLRCEATGHPTP--ALMWIKSAKRNLYNQGCC 326

  Fly   232 -------DTE--------LVSDSARGGIRVESEQQMKTSNLVISRVQHTDSGNYTCSADN 276
                   |||        .|.:|.|.|:|        .|.:.::.:.::|:|.|.|.|.|
Zfish   327 KQTQSSLDTERFPKKLFGYVQESPRVGVR--------WSVVSLNGISYSDAGEYRCRAQN 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 23/143 (16%)
IG_like 98..179 CDD:214653 19/117 (16%)
IG_like 206..278 CDD:214653 24/98 (24%)
Ig 211..278 CDD:143165 22/93 (24%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470 5/12 (42%)
leucine-rich repeat 69..89 CDD:275380 5/9 (56%)
LRR_8 112..172 CDD:290566 8/59 (14%)
leucine-rich repeat 114..137 CDD:275378 4/22 (18%)
leucine-rich repeat 138..161 CDD:275378 1/22 (5%)
LRR_8 160..214 CDD:290566 12/53 (23%)
LRR_4 160..201 CDD:289563 8/40 (20%)
leucine-rich repeat 162..185 CDD:275378 5/22 (23%)
leucine-rich repeat 186..199 CDD:275378 1/12 (8%)
leucine-rich repeat 215..230 CDD:275378 3/18 (17%)
Ig 278..391 CDD:299845 30/117 (26%)
I-set 279..391 CDD:254352 30/116 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.