DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr5 and si:ch211-66e2.3

DIOPT Version :9

Sequence 1:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001108576.1 Gene:si:ch211-66e2.3 / 100141487 ZFINID:ZDB-GENE-080226-7 Length:315 Species:Danio rerio


Alignment Length:217 Identity:48/217 - (22%)
Similarity:74/217 - (34%) Gaps:69/217 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YDAIDPVFDNTTDREVIAALGTTARLHCRVRHLG---DRAVSWIRQR---DLHILTIGIMTYTND 143
            |...|.|..:|.::.:|.  |....|.|.|.::.   ...|:|.:..   |....|..|.:..|.
Zfish   105 YKTPDSVSISTVNQTMIE--GNQYELQCDVYNVAPVQKLTVNWYKGETLVDQTSFTDTIKSPVNK 167

  Fly   144 QRFLARHIDNSDEWVLKIVSVQQRDAGVYECQV---------------STEP-KISLAYKLVVVT 192
            ...|....|.:|            |.....|:|               ::|| :|::.||     
Zfish   168 TSKLLIRPDRAD------------DGAQIRCEVELNLGEEGPQPPPTNTSEPLRITVYYK----- 215

  Fly   193 SKAQILANRELFIQSGSDINLTCIAPQAPGP-YTHMLWHKD--TELVSDSARGGIRVESEQQMKT 254
               ...:|....|...:|::|.|.....|.. |:   ||.:  ||.:|.|.           :::
Zfish   216 ---PKHSNSTEIISWSNDVSLNCTVKANPAAVYS---WHSEHLTEKISSSV-----------IQS 263

  Fly   255 SNLVISRVQHTDSGNYTCSADN 276
            |.|        ..|||||.|.|
Zfish   264 STL--------SPGNYTCIATN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr5NP_650080.3 V-set 95..191 CDD:284989 23/117 (20%)
IG_like 98..179 CDD:214653 17/101 (17%)
IG_like 206..278 CDD:214653 20/74 (27%)
Ig 211..278 CDD:143165 19/69 (28%)
si:ch211-66e2.3NP_001108576.1 Ig 108..208 CDD:299845 21/113 (19%)
Ig_3 215..277 CDD:290638 22/91 (24%)
IG_like 230..288 CDD:214653 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.