DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and PGLYRP1

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_005082.1 Gene:PGLYRP1 / 8993 HGNCID:8904 Length:196 Species:Homo sapiens


Alignment Length:169 Identity:60/169 - (35%)
Similarity:98/169 - (57%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERG 112
            |....:.::.|::|.|...:..:|...|..||::.|: ..:.|.:...|.:..|::|.:|....|
Human    26 DPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHT-AGSSCNTPASCQQQARNVQHYHMKTLG 89

  Fly   113 WNDIGYSFGIGGDGMIYTGRGFNVIGAHAPK-YNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAF 176
            |.|:||:|.||.||::|.|||:|..|||:.. :|..|:||..:|::...:|..|.:.||:.|:|.
Human    90 WCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLAC 154

  Fly   177 GVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHF 215
            ||.:|.:...|.|.|||.|:.|..||.:|:..|.:|||:
Human   155 GVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 50/142 (35%)
PGLYRP1NP_005082.1 PGRP 31..173 CDD:128941 50/142 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.