DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and Pglyrp2

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_006524773.1 Gene:Pglyrp2 / 57757 MGIID:1928099 Length:544 Species:Mus musculus


Alignment Length:250 Identity:87/250 - (34%)
Similarity:127/250 - (50%) Gaps:42/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GDKV--------SGSVSTSGPT-------SLAIL--MDSEQLEQQQLATSCGYSQHMQQANLGDG 49
            ||.|        :|:..||.||       :|.:|  ::.|.|:.|.::    ..|..|.|.|...
Mouse   290 GDPVFRSNFRRQNGAALTSAPTLAQQVWEALVLLQKLEPEHLQLQNIS----QEQLAQVATLATK 350

  Fly    50 VATARLLS------RSDWGARLPKSVEHFQG-PAP------YVIIHHSYMPA-VCYSTPDCMKSM 100
            ..|...|.      |..|||      ..::| |.|      ::.:||:|:|| .|.:...|...|
Mouse   351 EFTEAFLGCPAIHPRCRWGA------APYRGHPTPLRLPLGFLYVHHTYVPAPPCTTFQSCAADM 409

  Fly   101 RDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQ 165
            |.||.|||..|.|:||||||.:|.||.:|.|||::.:|||...||.:..|:..:|::...||.:.
Mouse   410 RSMQRFHQDVRKWDDIGYSFVVGSDGYLYQGRGWHWVGAHTRGYNSRGFGVAFVGNYTGSLPNEA 474

  Fly   166 MLDAAKN-LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHIN 219
            .|:..:: |.:..:..|.:.|.||||||||:..|.|||..||..:.:|||||.::
Mouse   475 ALNTVRDALPSCAIRAGLLRPDYKLLGHRQLVLTHCPGNALFNLLRTWPHFTEVS 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 57/156 (37%)
Pglyrp2XP_006524773.1 PGRP 360..505 CDD:128941 56/150 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I6007
eggNOG 1 0.900 - - E1_2CMNT
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H49671
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9951
SonicParanoid 1 1.000 - - X5082
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.