DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and pglyrp2

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001038631.1 Gene:pglyrp2 / 568634 ZFINID:ZDB-GENE-071227-1 Length:458 Species:Danio rerio


Alignment Length:217 Identity:73/217 - (33%)
Similarity:110/217 - (50%) Gaps:21/217 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKVSGSVSTSGPTSLAILMDSEQLEQQQLATSCGYSQHMQQANLGDGVATARLLSRSDWGARLPK 67
            :||:|.:.:.|...|..|:.....|.......|                 ..::.|..|||..|:
Zfish   252 EKVAGVLPSQGDAELESLIAKGIKEFVLRYMDC-----------------PSIIPRCIWGAAPPQ 299

  Fly    68 -SVEHFQGPAPYVIIHHSYMPA-VCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYT 130
             .:|....|..::.|||:.:|: .|.:...|.::||.||.|||.:.||.||||||.:|.||.||.
Zfish   300 VPLELLSPPMSFLYIHHTAIPSKPCLNLQTCSQNMRAMQRFHQKDWGWYDIGYSFVVGSDGYIYE 364

  Fly   131 GRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAK-NLIAFGVFKGYIDPAYKLLGHRQ 194
            |||:...|||....|:...|:..|||:...||....::..: :|:..||..|::...:.:|||||
Zfish   365 GRGWMSQGAHTKGRNNVGYGVAFIGDYSGRLPSTHDMELVRHHLVKCGVNNGFLQEDFTILGHRQ 429

  Fly   195 -VRDTECPGGRLFAEISSWPHF 215
             |..|.|||..|::||::|.|:
Zfish   430 VVVTTSCPGNALYSEITTWMHY 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 55/145 (38%)
pglyrp2NP_001038631.1 PGRP 285..430 CDD:128941 54/144 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMNT
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H49671
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9951
SonicParanoid 1 1.000 - - X5082
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.