DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and pglyrp5

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001037786.1 Gene:pglyrp5 / 553387 ZFINID:ZDB-GENE-050419-71 Length:238 Species:Danio rerio


Alignment Length:155 Identity:60/155 - (38%)
Similarity:90/155 - (58%) Gaps:1/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIG 117
            |..:||..|.|..|:.:...:.||..||:||:.: ..|....:.:..:..:|..|..|||::|||
Zfish    68 ADTVSRRGWDAVQPREMTQMESPAHTVIVHHTAL-RFCAHPRESVTELAHIQRMHMQERGFDDIG 131

  Fly   118 YSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGY 182
            |:|.|.|||.:|.|||:.::||||.::|..||||..:|:...:||....|.|...|:..||..|:
Zfish   132 YNFLISGDGTVYEGRGWGIVGAHAKEHNFYSVGIAFMGNLNADLPSSASLSALLRLLHIGVLHGH 196

  Fly   183 IDPAYKLLGHRQVRDTECPGGRLFA 207
            :.|.:.||||:.|..|.|||..|::
Zfish   197 VRPNFVLLGHKDVAKTACPGENLYS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 54/141 (38%)
pglyrp5NP_001037786.1 PGRP 68..209 CDD:128941 54/141 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm26632
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.