DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and PGRP-SB1

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster


Alignment Length:158 Identity:71/158 - (44%)
Similarity:98/158 - (62%) Gaps:0/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGI 122
            ||.|||...:|.....|...|||||||..|..|.::..|.:.::::|..|:..|.::||||:|.:
  Fly    30 RSSWGAVSARSPSRISGAVDYVIIHHSDNPNGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYNFIV 94

  Fly   123 GGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAY 187
            .|||.:|.||||.:.|:|:|.||.||:|||.||::....|..|||..||:||.....:||:...|
  Fly    95 AGDGKVYEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELAKQRGYLKDNY 159

  Fly   188 KLLGHRQVRDTECPGGRLFAEISSWPHF 215
            .|.||||.:.|.|||..|:.||.:|||:
  Fly   160 TLFGHRQTKATSCPGDALYNEIKTWPHW 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 60/136 (44%)
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 60/136 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I6007
eggNOG 1 0.900 - - E1_2CMNT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm26632
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.