DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and PGRP-SB2

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster


Alignment Length:135 Identity:48/135 - (35%)
Similarity:73/135 - (54%) Gaps:23/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QLA-TSCGYSQHMQQANLGDGVATARLLSRSDW-----GARLPKSVEHFQGPAPYVIIHHSYMPA 88
            ||| ..||.:           :|..:::.||.|     ..|:|:    ...|...:||||: :.|
  Fly     4 QLALVLCGLT-----------LALGQIVPRSSWCPVPISPRMPR----LMVPVRLIIIHHT-VTA 52

  Fly    89 VCYSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVL 153
            .|::...|...:|.::..| :.|.:.||||:|.|||||.||.|.||.:.|.|||:||.:|:||..
  Fly    53 PCFNPHQCQLVLRQIRADH-MRRKFRDIGYNFLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAF 116

  Fly   154 IGDWR 158
            ||:::
  Fly   117 IGNFQ 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 42/111 (38%)
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 42/110 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm26632
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.