DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and Pglyrp4

DIOPT Version :10

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001159440.1 Gene:Pglyrp4 / 384997 MGIID:2686324 Length:375 Species:Mus musculus


Alignment Length:61 Identity:14/61 - (22%)
Similarity:26/61 - (42%) Gaps:16/61 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 INEIKGHYDSMR----KNIDVREQKSIEELGILAERQ-----LMENRN-----KVGALKSG 229
            |.::..|:||..    ..:.:.:.:.|::  |..|:|     :.:..|     |.|.||.|
Mouse   140 IGKLLDHFDSEHGKDTLGVPLLDHERIQQ--IWKEQQKHIQCIQDPENFPLYMKTGTLKKG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 4/15 (27%)
Pglyrp4NP_001159440.1 PGRP 58..192 CDD:128941 9/53 (17%)
PGRP 213..353 CDD:128941
Interaction with murein. /evidence=ECO:0000250 295..304
Interaction with murein. /evidence=ECO:0000250 355..356
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.