DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and PGRP-LD

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001137893.1 Gene:PGRP-LD / 3771920 FlyBaseID:FBgn0260458 Length:327 Species:Drosophila melanogaster


Alignment Length:139 Identity:32/139 - (23%)
Similarity:59/139 - (42%) Gaps:17/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGW-NDIGYSFGIGGDGMIYTGRGFNVIGAHAP 142
            ||..|:       .:.:|.....|:  .|:|||.. .::.|:|.:.||..::..:|::....:..
  Fly   197 VIFTHT-------GSNECHDDCPDV--LHKLERSHVGELPYNFLVAGDCQVFEAQGWHYRSQYPR 252

  Fly   143 KYND-KSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLF 206
            ..|. .|:.:..:|::....|....|.||:.||...:.:..:.|.|:|.......|.      |.
  Fly   253 DLNGIDSLVMAFVGNFSGRPPIDCQLMAAQALILESLKRRILQPIYQLFVLGSYTDA------LQ 311

  Fly   207 AEISSWPHF 215
            .|:..|||:
  Fly   312 RELRHWPHY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 26/117 (22%)
PGRP-LDNP_001137893.1 PGRP 169..306 CDD:128941 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.