DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and PGRP-SC2

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster


Alignment Length:176 Identity:70/176 - (39%)
Similarity:101/176 - (57%) Gaps:12/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 QANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHH---SYMPAVCYSTPDCMKSMRDMQ 104
            ||.||     ..::|:|:||.|...|.........|.:|||   :|    |.:...|:..::::|
  Fly    16 QAVLG-----VTIISKSEWGGRSATSKTSLANYLSYAVIHHTAGNY----CSTKAACITQLQNIQ 71

  Fly   105 DFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDA 169
            .:|....||.||||:|.|||||.:|.|||:||:||||..:|.||:||..:|::.|.......:.|
  Fly    72 AYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITA 136

  Fly   170 AKNLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHF 215
            ||.|::..|.:|.|...|.|.|||||..|||||..::.||.:|.::
  Fly   137 AKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNW 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 56/144 (39%)
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 56/144 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm26632
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.