DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and PGRP-SC1b

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001286209.1 Gene:PGRP-SC1b / 35861 FlyBaseID:FBgn0033327 Length:185 Species:Drosophila melanogaster


Alignment Length:182 Identity:70/182 - (38%)
Similarity:102/182 - (56%) Gaps:15/182 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SQHMQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHH---SYMPAVCYSTPDCMKS 99
            ||:|.|     ||   .::|:::||.|..|..........|.||||   ||    |.:...|...
  Fly    15 SQYMAQ-----GV---YVVSKAEWGGRGAKWTVGLGNYLSYAIIHHTAGSY----CETRAQCNAV 67

  Fly   100 MRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPK 164
            ::.:|::|....||.||||:|.|||||.:|.|||:|.:||||.::|..|:||..:|::..:....
  Fly    68 LQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNWDTLEP 132

  Fly   165 QMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFT 216
            .|:.||:.|:...|.:|.:...|.|.|||||..|||||..::.||..|.|::
  Fly   133 NMISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHWS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 53/144 (37%)
PGRP-SC1bNP_001286209.1 PGRP 22..163 CDD:128941 54/147 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMNT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm26632
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.