DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and PGRP-SA

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001285128.1 Gene:PGRP-SA / 32099 FlyBaseID:FBgn0030310 Length:203 Species:Drosophila melanogaster


Alignment Length:183 Identity:70/183 - (38%)
Similarity:100/183 - (54%) Gaps:9/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SCGYSQHMQQANLGDGVATARLLSRSDWGARLPKSVEHFQ-GPAPYVIIHHSYMPAVCYSTPDCM 97
            |.|.|:....||    ..|.:|  :..||.: |....|:| .|..||:|||: :...|.....|.
  Fly    25 SAGKSRQRSPAN----CPTIKL--KRQWGGK-PSLGLHYQVRPIRYVVIHHT-VTGECSGLLKCA 81

  Fly    98 KSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELP 162
            :.:::||.:||.|..:|||.|:|.||.||::|.|.|:.:.|||...||....||..||::..:||
  Fly    82 EILQNMQAYHQNELDFNDISYNFLIGNDGIVYEGTGWGLRGAHTYGYNAIGTGIAFIGNFVDKLP 146

  Fly   163 PKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHF 215
            ....|.|||:|:|.||.:|.:...|.|:...||..|:.||..|:.||..|||:
  Fly   147 SDAALQAAKDLLACGVQQGELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHW 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 53/142 (37%)
PGRP-SANP_001285128.1 PGRP 38..179 CDD:128941 54/144 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9951
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.