DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and Pglyrp2

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_038935975.1 Gene:Pglyrp2 / 299567 RGDID:1359183 Length:522 Species:Rattus norvegicus


Alignment Length:245 Identity:82/245 - (33%)
Similarity:122/245 - (49%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SGSVSTSGPT-------SLAILMDSE-------QLEQQQLATSCGY-SQHMQQANLGDGVATARL 55
            :|...||.||       :|.:|...|       .:.|:|||....: ::...:|.||    ...:
  Rat   294 NGVALTSAPTLAQQVWEALVLLQKLEPGHPRLQNMSQKQLAQVATFATKEFTEAFLG----CPAI 354

  Fly    56 LSRSDWGARLPKSVEHFQGPAPY-------------VIIHHSYMPA-VCYSTPDCMKSMRDMQDF 106
            ..|..|||            |||             :.:||:|:|| .|.:...|...||.||.|
  Rat   355 HPRCRWGA------------APYRGHPTPLRLPLGLLYVHHTYVPAPPCTTFQSCAADMRSMQRF 407

  Fly   107 HQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAK 171
            ||..|||.||||||.:|.||.:|.|||::.:|||...||.:..|:..:|::...||.:..|:..:
  Rat   408 HQNVRGWADIGYSFVVGSDGYVYQGRGWHWVGAHTLGYNSRGFGVAFVGNYTGSLPSEAALNTVR 472

  Fly   172 NLI-AFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHIND 220
            ::: :..:..|.:.|.|||.||||:..|:|||..||..:.:|||||.:.:
  Rat   473 DVLPSCAIRAGLLRPDYKLFGHRQLGKTDCPGNALFNLLRTWPHFTVVEN 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 55/156 (35%)
Pglyrp2XP_038935975.1 PGRP 352..497 CDD:128941 55/156 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMNT
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H49671
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5082
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.