DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and Pglyrp3

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_006501534.1 Gene:Pglyrp3 / 242100 MGIID:2685266 Length:359 Species:Mus musculus


Alignment Length:184 Identity:66/184 - (35%)
Similarity:96/184 - (52%) Gaps:6/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SCGYSQHMQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMK 98
            :|...||.:...    .|...:..||.|.|| .........||.:|||.|:...: |..:.||:.
Mouse   182 TCLVPQHSEIPK----KACPNITPRSAWEAR-ETHCPQMNLPAKFVIIIHTAGKS-CNESADCLV 240

  Fly    99 SMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPP 163
            .:||.|.||...:.:.||.|.|.:|.||.:|.|.|:|:.|:|...|||.::||..:|::..:.|.
Mouse   241 RVRDTQSFHIDNQDFCDIAYHFLVGQDGEVYEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPN 305

  Fly   164 KQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTH 217
            :..|.||::||...|.|||:...|.|:||..|.:...||..|:..|.:||||.|
Mouse   306 EASLKAAQSLIQCAVAKGYLTSNYLLMGHSDVSNILSPGQALYNIIKTWPHFKH 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 52/141 (37%)
Pglyrp3XP_006501534.1 PGRP 40..172 CDD:128941
PGRP 197..337 CDD:128941 52/141 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.