DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and PGLYRP3

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_011507420.1 Gene:PGLYRP3 / 114771 HGNCID:30014 Length:377 Species:Homo sapiens


Alignment Length:166 Identity:67/166 - (40%)
Similarity:95/166 - (57%) Gaps:8/166 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LLSRSDWGAR---LPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSMRDMQDFHQLERGWNDI 116
            ::.||.|.||   .||    ...||.||||.|:...:...|| ||...:|::|.||...|.:.||
Human   217 IIKRSAWEARETHCPK----MNLPAKYVIIIHTAGTSCTVST-DCQTVVRNIQSFHMDTRNFCDI 276

  Fly   117 GYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKG 181
            ||.|.:|.||.:|.|.|:::.|:|...:||.::||..||.:..:.|....|:||::||...|.:|
Human   277 GYHFLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIAFIGYFVEKPPNAAALEAAQDLIQCAVVEG 341

  Fly   182 YIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTH 217
            |:.|.|.|:||..|.:...||..|:..||:||||.|
Human   342 YLTPNYLLMGHSDVVNILSPGQALYNIISTWPHFKH 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 56/142 (39%)
PGLYRP3XP_011507420.1 PGRP 57..195 CDD:128941
PGRP 215..355 CDD:128941 56/142 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9951
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.