DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and PGLYRP2

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001350475.1 Gene:PGLYRP2 / 114770 HGNCID:30013 Length:634 Species:Homo sapiens


Alignment Length:254 Identity:84/254 - (33%)
Similarity:123/254 - (48%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSLAILMDS--------EQLEQQQLATSCGYSQHMQQANLGDGVATA------------RLLSRS 59
            ||.:||...        ::||...|...|     |.|..|....|.|            .:..|.
Human   327 TSASILAQQVWGTLVLLQRLEPVHLQLQC-----MSQEQLAQVAANATKEFTEAFLGCPAIHPRC 386

  Fly    60 DWGAR----LPKSVEHFQGPAPYVIIHHSYMPA-VCYSTPDCMKSMRDMQDFHQLERGWNDIGYS 119
            .|||.    .||.:   |.|..::.:||:|:|| .|.....|..:||.||.:||..:||.|||||
Human   387 RWGAAPYRGRPKLL---QLPLGFLYVHHTYVPAPPCTDFTRCAANMRSMQRYHQDTQGWGDIGYS 448

  Fly   120 FGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRTELPPKQMLDAAKN-LIAFGVFKGYI 183
            |.:|.||.:|.|||::.:|||...:|.:..|:.::|::...||.:..|...:: |.:..|..|.:
Human   449 FVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAALPTEAALRTVRDTLPSCAVRAGLL 513

  Fly   184 DPAYKLLGHRQVRDTECPGGRLFAEISSWPHFTHIN---------DTEGVSSTTAPVVP 233
            .|.|.||||||:..|:|||..||..:.:|||||.::         .....:|:|.|:.|
Human   514 RPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTAVSLRSLHYTARRPSVYTSSTRPLPP 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 56/159 (35%)
PGLYRP2NP_001350475.1 PGRP 380..525 CDD:128941 55/147 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMNT
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H49671
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9951
SonicParanoid 1 1.000 - - X5082
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.660

Return to query results.
Submit another query.