DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-LB and pglyrp2

DIOPT Version :9

Sequence 1:NP_001247052.1 Gene:PGRP-LB / 41379 FlyBaseID:FBgn0037906 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001106487.2 Gene:pglyrp2 / 100127677 XenbaseID:XB-GENE-5779913 Length:497 Species:Xenopus tropicalis


Alignment Length:187 Identity:77/187 - (41%)
Similarity:100/187 - (53%) Gaps:13/187 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QQANLGDGVATAR----------LLSRSDWGARLPKSVEHFQG-PAPYVIIHHSYMPA-VCYSTP 94
            :|..:..|.|...          ::.|..|||:..|....|.| |...|.|||:|.|: .|.|..
 Frog   308 EQIKIAAGAAAREFEQYFLDCPAVIPRCMWGAKRYKGKPIFLGLPLSRVFIHHTYEPSQPCTSFS 372

  Fly    95 DCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGIVLIGDWRT 159
            .|..:||.||.|||.:|||:||||||.:|.:|.:|.|||:|..|||...||....|:..|||:.:
 Frog   373 QCAANMRSMQRFHQQDRGWDDIGYSFVVGSNGYLYEGRGWNRAGAHTRGYNSVGYGVSFIGDYTS 437

  Fly   160 ELPPKQMLDAAKN-LIAFGVFKGYIDPAYKLLGHRQVRDTECPGGRLFAEISSWPHF 215
            .:|...:|...|: .:...|..|||.|.|.:.|||||..|.|||..|:.||.||.||
 Frog   438 IVPKDSILALVKDRFLRCAVRLGYITPNYIIQGHRQVVSTSCPGDALYKEIQSWDHF 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-LBNP_001247052.1 PGRP 53..195 CDD:128941 61/154 (40%)
pglyrp2NP_001106487.2 PGRP 329..474 CDD:128941 61/144 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5729
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H49671
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5082
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.