DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5281 and AT3G07080

DIOPT Version :10

Sequence 1:NP_650076.1 Gene:CG5281 / 41375 FlyBaseID:FBgn0037902 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_187364.1 Gene:AT3G07080 / 819894 AraportID:AT3G07080 Length:438 Species:Arabidopsis thaliana


Alignment Length:82 Identity:19/82 - (23%)
Similarity:36/82 - (43%) Gaps:7/82 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 RDRW-------LVVVLGVFSFLGQILLTLSLQIEQAGPVAIARCADIVFAFVWQMLFFGETPTAY 307
            :.||       :.:|:..|.||.|:...:||:........|...|..:|.|:..::|.||..|..
plant   155 KGRWTRMRVAKVSLVICPFWFLAQLTFNVSLKYTTVTSNTILSSASSLFTFLVSLIFLGEKFTWL 219

  Fly   308 SLVGAVMVMGSVVLTAL 324
            .|...::.|...::.::
plant   220 KLFSVLLCMSGTIIVSM 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5281NP_650076.1 RhaT 36..326 CDD:440461 19/82 (23%)
AT3G07080NP_187364.1 RhaT <175..399 CDD:440461 15/62 (24%)

Return to query results.
Submit another query.